Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 50573..51349 | Replicon | chromosome |
Accession | NZ_CP113052 | ||
Organism | Staphylococcus aureus strain Fizz |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | OS084_RS00285 | Protein ID | WP_000031108.1 |
Coordinates | 50573..50725 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | OS084_RS00290 | Protein ID | WP_001251224.1 |
Coordinates | 50750..51349 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS084_RS00270 (46536) | 46536..47357 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
OS084_RS00275 (47820) | 47820..49205 | - | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
OS084_RS00280 (49401) | 49401..49796 | - | 396 | WP_000901021.1 | hypothetical protein | - |
OS084_RS00285 (50573) | 50573..50725 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
OS084_RS00290 (50750) | 50750..51349 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
OS084_RS00295 (51508) | 51508..51978 | - | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
OS084_RS00300 (51983) | 51983..53110 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
OS084_RS00305 (53261) | 53261..53983 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
OS084_RS00310 (53976) | 53976..55433 | - | 1458 | WP_267838003.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T265339 WP_000031108.1 NZ_CP113052:c50725-50573 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT265339 WP_001251224.1 NZ_CP113052:c51349-50750 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|