Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1756935..1757464 | Replicon | chromosome |
Accession | NZ_CP113051 | ||
Organism | Staphylococcus aureus strain Viktor |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS088_RS09035 | Protein ID | WP_000621175.1 |
Coordinates | 1756935..1757297 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | OS088_RS09040 | Protein ID | WP_000948330.1 |
Coordinates | 1757294..1757464 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS088_RS09015 (1753915) | 1753915..1754685 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
OS088_RS09020 (1754660) | 1754660..1755139 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
OS088_RS09025 (1755141) | 1755141..1755467 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS088_RS09030 (1755586) | 1755586..1756587 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS088_RS09035 (1756935) | 1756935..1757297 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS088_RS09040 (1757294) | 1757294..1757464 | - | 171 | WP_000948330.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS088_RS09045 (1757549) | 1757549..1758697 | - | 1149 | WP_001281148.1 | alanine racemase | - |
OS088_RS09050 (1758763) | 1758763..1759122 | - | 360 | WP_000581193.1 | holo-ACP synthase | - |
OS088_RS09055 (1759126) | 1759126..1759617 | - | 492 | WP_154283807.1 | PH domain-containing protein | - |
OS088_RS09060 (1759604) | 1759604..1761187 | - | 1584 | WP_209205797.1 | PH domain-containing protein | - |
OS088_RS09065 (1761180) | 1761180..1761659 | - | 480 | WP_154283805.1 | hypothetical protein | - |
OS088_RS09070 (1761868) | 1761868..1762428 | - | 561 | WP_154283804.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265333 WP_000621175.1 NZ_CP113051:c1757297-1756935 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|