Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1543285..1544061 | Replicon | chromosome |
Accession | NZ_CP113051 | ||
Organism | Staphylococcus aureus strain Viktor |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | OS088_RS07735 | Protein ID | WP_000031108.1 |
Coordinates | 1543285..1543437 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | OS088_RS07740 | Protein ID | WP_154284644.1 |
Coordinates | 1543462..1544061 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS088_RS07720 (1539733) | 1539733..1540128 | - | 396 | WP_000901023.1 | hypothetical protein | - |
OS088_RS07725 (1541013) | 1541013..1541774 | - | 762 | WP_001066123.1 | IS21-like element helper ATPase IstB | - |
OS088_RS07730 (1541767) | 1541767..1543059 | - | 1293 | WP_267814037.1 | IS21 family transposase | - |
OS088_RS07735 (1543285) | 1543285..1543437 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
OS088_RS07740 (1543462) | 1543462..1544061 | - | 600 | WP_154284644.1 | glucosamine-6-phosphate isomerase | Antitoxin |
OS088_RS07745 (1544220) | 1544220..1544690 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
OS088_RS07750 (1544695) | 1544695..1545822 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
OS088_RS07755 (1545972) | 1545972..1546694 | - | 723 | WP_209206048.1 | amino acid ABC transporter ATP-binding protein | - |
OS088_RS07760 (1546687) | 1546687..1548144 | - | 1458 | WP_154284642.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1541013..1541777 | 764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T265328 WP_000031108.1 NZ_CP113051:c1543437-1543285 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22357.50 Da Isoelectric Point: 5.1445
>AT265328 WP_154284644.1 NZ_CP113051:c1544061-1543462 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNISIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNISIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|