Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 428050..428576 | Replicon | chromosome |
| Accession | NZ_CP113051 | ||
| Organism | Staphylococcus aureus strain Viktor | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | - |
| Locus tag | OS088_RS02190 | Protein ID | WP_267814573.1 |
| Coordinates | 428256..428576 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | - |
| Locus tag | OS088_RS02185 | Protein ID | WP_267814571.1 |
| Coordinates | 428050..428253 (+) | Length | 68 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS088_RS02155 (424201) | 424201..425223 | - | 1023 | Protein_411 | site-specific integrase | - |
| OS088_RS02160 (425265) | 425265..426626 | - | 1362 | WP_267814566.1 | SAP domain-containing protein | - |
| OS088_RS02165 (426653) | 426653..427226 | - | 574 | Protein_413 | helix-turn-helix transcriptional regulator | - |
| OS088_RS02170 (427398) | 427398..427619 | + | 222 | WP_000560872.1 | helix-turn-helix transcriptional regulator | - |
| OS088_RS02175 (427620) | 427620..427892 | + | 273 | WP_000124597.1 | helix-turn-helix domain-containing protein | - |
| OS088_RS02180 (427904) | 427904..428050 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| OS088_RS02185 (428050) | 428050..428253 | + | 204 | WP_267814571.1 | pathogenicity island protein | Antitoxin |
| OS088_RS02190 (428256) | 428256..428576 | + | 321 | WP_267814573.1 | DUF1474 family protein | Toxin |
| OS088_RS02195 (428643) | 428643..429512 | + | 870 | WP_077517454.1 | primase alpha helix C-terminal domain-containing protein | - |
| OS088_RS02200 (429526) | 429526..431237 | + | 1712 | Protein_420 | DUF927 domain-containing protein | - |
| OS088_RS02205 (431567) | 431567..431947 | + | 381 | WP_000356930.1 | hypothetical protein | - |
| OS088_RS02210 (431944) | 431944..432585 | + | 642 | WP_064132047.1 | pathogenicity island protein | - |
| OS088_RS02215 (432932) | 432932..433273 | + | 342 | WP_001161492.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 403937..435587 | 31650 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12493.16 Da Isoelectric Point: 4.7203
>T265327 WP_267814573.1 NZ_CP113051:428256-428576 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNELETKQEHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASSDGTLATESDDAKKLKITE
MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNELETKQEHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASSDGTLATESDDAKKLKITE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|