Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 409287..409764 Replicon chromosome
Accession NZ_CP113051
Organism Staphylococcus aureus strain Viktor

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag OS088_RS02045 Protein ID WP_000052076.1
Coordinates 409287..409475 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS088_RS02050 Protein ID WP_001059690.1
Coordinates 409504..409764 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS088_RS02015 (405289) 405289..405798 + 510 WP_154284636.1 hypothetical protein -
OS088_RS02020 (406139) 406139..406825 + 687 WP_154284540.1 thermonuclease family protein -
OS088_RS02025 (407182) 407182..407382 + 201 WP_001059082.1 cold-shock protein -
OS088_RS02030 (407878) 407878..408096 - 219 WP_000005884.1 hypothetical protein -
OS088_RS02035 (408158) 408158..408442 - 285 WP_154284539.1 hypothetical protein -
OS088_RS02040 (408530) 408530..409099 - 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
OS088_RS02045 (409287) 409287..409475 - 189 WP_000052076.1 hypothetical protein Toxin
OS088_RS02050 (409504) 409504..409764 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS088_RS02055 (410104) 410104..410307 + 204 WP_154284538.1 sterile alpha motif-like domain-containing protein -
OS088_RS02060 (410304) 410304..410540 - 237 WP_000368687.1 hypothetical protein -
OS088_RS02065 (410765) 410765..411346 + 582 WP_001140697.1 histidine phosphatase family protein -
OS088_RS02070 (411419) 411419..412036 - 618 WP_154284537.1 LysE/ArgO family amino acid transporter -
OS088_RS02075 (412190) 412190..412684 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS088_RS02080 (413062) 413062..413484 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
OS088_RS02085 (413632) 413632..414348 + 717 WP_154284536.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 403937..435587 31650


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T265326 WP_000052076.1 NZ_CP113051:c409475-409287 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265326 WP_001059690.1 NZ_CP113051:c409764-409504 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References