265324

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /-
Location 2895396..2896081 Replicon chromosome
Accession NZ_CP113049
Organism Staphylococcus aureus strain Ahri

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag OS089_RS14495 Protein ID WP_267814154.1
Coordinates 2895396..2895857 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag OS089_RS14500 Protein ID WP_267814158.1
Coordinates 2895944..2896081 (-) Length 46 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS089_RS14435 (2891919) 2891919..2892473 + 555 WP_000132890.1 alpha/beta hydrolase -
OS089_RS14480 (2893751) 2893751..2894800 - 1050 WP_267813968.1 site-specific integrase -
OS089_RS14485 (2894862) 2894862..2894999 - 138 WP_225370885.1 hypothetical protein -
OS089_RS14490 (2895208) 2895208..2895378 - 171 WP_267813969.1 hypothetical protein -
OS089_RS14495 (2895396) 2895396..2895857 - 462 WP_267814154.1 toxin Toxin
OS089_RS14500 (2895944) 2895944..2896081 - 138 WP_267814158.1 hypothetical protein Antitoxin
OS089_RS14505 (2896038) 2896038..2896196 - 159 WP_267813970.1 helix-turn-helix transcriptional regulator -
OS089_RS14510 (2896362) 2896362..2896511 + 150 WP_267793740.1 hypothetical protein -
OS089_RS14515 (2896626) 2896626..2897069 + 444 WP_000435360.1 hypothetical protein -
OS089_RS14520 (2897084) 2897084..2897224 + 141 WP_000939495.1 hypothetical protein -
OS089_RS14525 (2897217) 2897217..2897426 - 210 WP_000772137.1 hypothetical protein -
OS089_RS14530 (2897483) 2897483..2898196 + 714 WP_031925041.1 BRO family protein -
OS089_RS14535 (2898209) 2898209..2898418 + 210 WP_000455727.1 hypothetical protein -
OS089_RS14540 (2898432) 2898432..2898593 + 162 WP_000048124.1 DUF1270 family protein -
OS089_RS14545 (2898682) 2898682..2898999 + 318 WP_267813971.1 hypothetical protein -
OS089_RS14550 (2899004) 2899004..2899264 + 261 WP_001556704.1 DUF1108 family protein -
OS089_RS14555 (2899277) 2899277..2899813 + 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
OS089_RS14560 (2899814) 2899814..2900464 + 651 WP_000840496.1 ERF family protein -
OS089_RS14565 (2900461) 2900461..2900904 + 444 WP_001099007.1 single-stranded DNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2882964..2922598 39634


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18159.52 Da        Isoelectric Point: 4.6915

>T265324 WP_267814154.1 NZ_CP113049:c2895857-2895396 [Staphylococcus aureus]
MRLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 46 a.a.        Molecular weight: 5186.29 Da        Isoelectric Point: 10.4114

>AT265324 WP_267814158.1 NZ_CP113049:c2896081-2895944 [Staphylococcus aureus]
MKTVAEKIPMEDIAEIANALKVTPRIFTIKKIDKQKTKYNIVQLI

Download         Length: 138 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References