Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /- |
| Location | 2895396..2896081 | Replicon | chromosome |
| Accession | NZ_CP113049 | ||
| Organism | Staphylococcus aureus strain Ahri | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OS089_RS14495 | Protein ID | WP_267814154.1 |
| Coordinates | 2895396..2895857 (-) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OS089_RS14500 | Protein ID | WP_267814158.1 |
| Coordinates | 2895944..2896081 (-) | Length | 46 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS089_RS14435 (2891919) | 2891919..2892473 | + | 555 | WP_000132890.1 | alpha/beta hydrolase | - |
| OS089_RS14480 (2893751) | 2893751..2894800 | - | 1050 | WP_267813968.1 | site-specific integrase | - |
| OS089_RS14485 (2894862) | 2894862..2894999 | - | 138 | WP_225370885.1 | hypothetical protein | - |
| OS089_RS14490 (2895208) | 2895208..2895378 | - | 171 | WP_267813969.1 | hypothetical protein | - |
| OS089_RS14495 (2895396) | 2895396..2895857 | - | 462 | WP_267814154.1 | toxin | Toxin |
| OS089_RS14500 (2895944) | 2895944..2896081 | - | 138 | WP_267814158.1 | hypothetical protein | Antitoxin |
| OS089_RS14505 (2896038) | 2896038..2896196 | - | 159 | WP_267813970.1 | helix-turn-helix transcriptional regulator | - |
| OS089_RS14510 (2896362) | 2896362..2896511 | + | 150 | WP_267793740.1 | hypothetical protein | - |
| OS089_RS14515 (2896626) | 2896626..2897069 | + | 444 | WP_000435360.1 | hypothetical protein | - |
| OS089_RS14520 (2897084) | 2897084..2897224 | + | 141 | WP_000939495.1 | hypothetical protein | - |
| OS089_RS14525 (2897217) | 2897217..2897426 | - | 210 | WP_000772137.1 | hypothetical protein | - |
| OS089_RS14530 (2897483) | 2897483..2898196 | + | 714 | WP_031925041.1 | BRO family protein | - |
| OS089_RS14535 (2898209) | 2898209..2898418 | + | 210 | WP_000455727.1 | hypothetical protein | - |
| OS089_RS14540 (2898432) | 2898432..2898593 | + | 162 | WP_000048124.1 | DUF1270 family protein | - |
| OS089_RS14545 (2898682) | 2898682..2898999 | + | 318 | WP_267813971.1 | hypothetical protein | - |
| OS089_RS14550 (2899004) | 2899004..2899264 | + | 261 | WP_001556704.1 | DUF1108 family protein | - |
| OS089_RS14555 (2899277) | 2899277..2899813 | + | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| OS089_RS14560 (2899814) | 2899814..2900464 | + | 651 | WP_000840496.1 | ERF family protein | - |
| OS089_RS14565 (2900461) | 2900461..2900904 | + | 444 | WP_001099007.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2882964..2922598 | 39634 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18159.52 Da Isoelectric Point: 4.6915
>T265324 WP_267814154.1 NZ_CP113049:c2895857-2895396 [Staphylococcus aureus]
MRLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MRLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|