Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2714564..2715093 | Replicon | chromosome |
| Accession | NZ_CP113049 | ||
| Organism | Staphylococcus aureus strain Ahri | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OS089_RS13445 | Protein ID | WP_000621175.1 |
| Coordinates | 2714731..2715093 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | OS089_RS13440 | Protein ID | WP_000948331.1 |
| Coordinates | 2714564..2714734 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS089_RS13410 (2709600) | 2709600..2710160 | + | 561 | WP_001092405.1 | K(+)-transporting ATPase subunit C | - |
| OS089_RS13415 (2710369) | 2710369..2710848 | + | 480 | WP_001287083.1 | hypothetical protein | - |
| OS089_RS13420 (2710841) | 2710841..2712424 | + | 1584 | WP_267813953.1 | PH domain-containing protein | - |
| OS089_RS13425 (2712411) | 2712411..2712902 | + | 492 | WP_001205915.1 | PH domain-containing protein | - |
| OS089_RS13430 (2712906) | 2712906..2713265 | + | 360 | WP_000581194.1 | holo-ACP synthase | - |
| OS089_RS13435 (2713331) | 2713331..2714479 | + | 1149 | WP_001280702.1 | alanine racemase | - |
| OS089_RS13440 (2714564) | 2714564..2714734 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| OS089_RS13445 (2714731) | 2714731..2715093 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OS089_RS13450 (2715442) | 2715442..2716443 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| OS089_RS13455 (2716562) | 2716562..2716888 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| OS089_RS13460 (2716890) | 2716890..2717369 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| OS089_RS13465 (2717344) | 2717344..2718114 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265322 WP_000621175.1 NZ_CP113049:2714731-2715093 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|