Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1111095..1111572 Replicon chromosome
Accession NZ_CP113049
Organism Staphylococcus aureus strain Ahri

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag OS089_RS05610 Protein ID WP_000052076.1
Coordinates 1111384..1111572 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag OS089_RS05605 Protein ID WP_160199178.1
Coordinates 1111095..1111355 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS089_RS05570 (1106487) 1106487..1107203 - 717 WP_000150029.1 type I 3-dehydroquinate dehydratase -
OS089_RS05575 (1107351) 1107351..1107773 + 423 WP_000974455.1 organic hydroperoxide resistance protein -
OS089_RS05580 (1108172) 1108172..1108666 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
OS089_RS05585 (1108822) 1108822..1109439 + 618 WP_000255554.1 LysE/ArgO family amino acid transporter -
OS089_RS05590 (1109512) 1109512..1110093 - 582 WP_001140697.1 histidine phosphatase family protein -
OS089_RS05595 (1110318) 1110318..1110554 + 237 WP_000368687.1 hypothetical protein -
OS089_RS05600 (1110551) 1110551..1110754 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS089_RS05605 (1111095) 1111095..1111355 + 261 WP_160199178.1 hypothetical protein Antitoxin
OS089_RS05610 (1111384) 1111384..1111572 + 189 WP_000052076.1 hypothetical protein Toxin
OS089_RS05615 (1111760) 1111760..1112329 + 570 WP_001106657.1 lipoprotein N-acylation protein LnsA -
OS089_RS05620 (1112417) 1112417..1112701 + 285 WP_001004397.1 hypothetical protein -
OS089_RS05625 (1112763) 1112763..1112981 + 219 WP_000005888.1 hypothetical protein -
OS089_RS05630 (1113480) 1113480..1113680 - 201 WP_001059082.1 cold-shock protein -
OS089_RS05635 (1114037) 1114037..1114723 - 687 WP_001823812.1 thermonuclease family protein -
OS089_RS05640 (1115064) 1115064..1115534 - 471 WP_000824462.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - seb / selq / selk / vWbp 1033369..1125777 92408


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T265315 WP_000052076.1 NZ_CP113049:1111384-1111572 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9974.11 Da        Isoelectric Point: 4.0624

>AT265315 WP_160199178.1 NZ_CP113049:1111095-1111355 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWFLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure

References