Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 1093344..1093876 Replicon chromosome
Accession NZ_CP113049
Organism Staphylococcus aureus strain Ahri

Toxin (Protein)


Gene name TscT Uniprot ID Q93CD4
Locus tag OS089_RS05465 Protein ID WP_001103942.1
Coordinates 1093344..1093664 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag OS089_RS05470 Protein ID WP_001058486.1
Coordinates 1093667..1093876 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS089_RS05435 (1088495) 1088495..1088836 - 342 WP_001190615.1 hypothetical protein -
OS089_RS05440 (1089353) 1089353..1089994 - 642 WP_021758233.1 pathogenicity island protein -
OS089_RS05445 (1089991) 1089991..1090275 - 285 WP_000998181.1 hypothetical protein -
OS089_RS05450 (1090277) 1090277..1090639 - 363 WP_001039168.1 hypothetical protein -
OS089_RS05455 (1090925) 1090925..1092394 - 1470 WP_000390454.1 virulence-associated E family protein -
OS089_RS05460 (1092411) 1092411..1093280 - 870 WP_001002732.1 primase alpha helix C-terminal domain-containing protein -
OS089_RS05465 (1093344) 1093344..1093664 - 321 WP_001103942.1 DUF1474 family protein Toxin
OS089_RS05470 (1093667) 1093667..1093876 - 210 WP_001058486.1 hypothetical protein Antitoxin
OS089_RS05475 (1093869) 1093869..1094015 - 147 WP_000784875.1 hypothetical protein -
OS089_RS05480 (1094027) 1094027..1094299 - 273 WP_000091731.1 helix-turn-helix domain-containing protein -
OS089_RS05485 (1094292) 1094292..1094555 - 264 WP_000243851.1 helix-turn-helix transcriptional regulator -
OS089_RS05490 (1094748) 1094748..1095080 + 333 WP_001260004.1 helix-turn-helix transcriptional regulator -
OS089_RS05495 (1095092) 1095092..1095550 + 459 WP_000281657.1 ImmA/IrrE family metallo-endopeptidase -
OS089_RS05500 (1095567) 1095567..1095998 + 432 WP_001228759.1 hypothetical protein -
OS089_RS05505 (1096068) 1096068..1096796 + 729 WP_001033316.1 staphylococcal enterotoxin type Q -
OS089_RS05510 (1096820) 1096820..1097548 + 729 WP_000733774.1 staphylococcal enterotoxin type K -
OS089_RS05515 (1097637) 1097637..1098857 + 1221 WP_267814090.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - seb / selq / selk / vWbp 1033369..1125777 92408


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12694.22 Da        Isoelectric Point: 4.7419

>T265314 WP_001103942.1 NZ_CP113049:c1093664-1093344 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT265314 WP_001058486.1 NZ_CP113049:c1093876-1093667 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q93CD4

Antitoxin

Source ID Structure

References