Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1904597..1905074 Replicon chromosome
Accession NZ_CP113047
Organism Staphylococcus aureus strain Sett

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag OS087_RS09585 Protein ID WP_000052076.1
Coordinates 1904597..1904785 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS087_RS09590 Protein ID WP_001059690.1
Coordinates 1904814..1905074 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS087_RS09555 (1900632) 1900632..1901102 + 471 WP_000824472.1 hypothetical protein -
OS087_RS09560 (1901443) 1901443..1902129 + 687 WP_001566557.1 thermonuclease family protein -
OS087_RS09565 (1902486) 1902486..1902686 + 201 WP_001059082.1 cold-shock protein -
OS087_RS09570 (1903181) 1903181..1903406 - 226 Protein_1836 hypothetical protein -
OS087_RS09575 (1903468) 1903468..1903752 - 285 WP_001004394.1 hypothetical protein -
OS087_RS09580 (1903840) 1903840..1904409 - 570 WP_001106652.1 lipoprotein N-acylation protein LnsA -
OS087_RS09585 (1904597) 1904597..1904785 - 189 WP_000052076.1 hypothetical protein Toxin
OS087_RS09590 (1904814) 1904814..1905074 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS087_RS09595 (1905415) 1905415..1905618 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS087_RS09600 (1905615) 1905615..1905851 - 237 WP_000368687.1 hypothetical protein -
OS087_RS09605 (1906076) 1906076..1906657 + 582 WP_001140697.1 histidine phosphatase family protein -
OS087_RS09610 (1906730) 1906730..1907347 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS087_RS09615 (1907502) 1907502..1907996 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS087_RS09620 (1908395) 1908395..1908817 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS087_RS09625 (1908965) 1908965..1909681 + 717 WP_000150019.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T265310 WP_000052076.1 NZ_CP113047:c1904785-1904597 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265310 WP_001059690.1 NZ_CP113047:c1905074-1904814 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References