Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 379554..380083 | Replicon | chromosome |
Accession | NZ_CP113047 | ||
Organism | Staphylococcus aureus strain Sett |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS087_RS02140 | Protein ID | WP_000621175.1 |
Coordinates | 379554..379916 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS087_RS02145 | Protein ID | WP_000948331.1 |
Coordinates | 379913..380083 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS087_RS02120 (376533) | 376533..377303 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
OS087_RS02125 (377278) | 377278..377757 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
OS087_RS02130 (377759) | 377759..378085 | - | 327 | WP_050970665.1 | anti-sigma factor antagonist | - |
OS087_RS02135 (378204) | 378204..379205 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS087_RS02140 (379554) | 379554..379916 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS087_RS02145 (379913) | 379913..380083 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS087_RS02150 (380168) | 380168..381316 | - | 1149 | WP_001281154.1 | alanine racemase | - |
OS087_RS02155 (381382) | 381382..381741 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
OS087_RS02160 (381745) | 381745..382236 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
OS087_RS02165 (382223) | 382223..383807 | - | 1585 | Protein_388 | PH domain-containing protein | - |
OS087_RS02170 (383800) | 383800..384279 | - | 480 | WP_001287079.1 | hypothetical protein | - |
OS087_RS02175 (384488) | 384488..385048 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265303 WP_000621175.1 NZ_CP113047:c379916-379554 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|