Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 182855..183631 | Replicon | chromosome |
| Accession | NZ_CP113047 | ||
| Organism | Staphylococcus aureus strain Sett | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | OS087_RS00880 | Protein ID | WP_000031108.1 |
| Coordinates | 182855..183007 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | OS087_RS00885 | Protein ID | WP_001251224.1 |
| Coordinates | 183032..183631 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS087_RS00865 (179058) | 179058..179879 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| OS087_RS00870 (180331) | 180331..181716 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
| OS087_RS00875 (181912) | 181912..182307 | - | 396 | WP_086353413.1 | hypothetical protein | - |
| OS087_RS00880 (182855) | 182855..183007 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| OS087_RS00885 (183032) | 183032..183631 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| OS087_RS00890 (183790) | 183790..184260 | - | 471 | WP_049311634.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| OS087_RS00895 (184265) | 184265..185392 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| OS087_RS00900 (185543) | 185543..186265 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| OS087_RS00905 (186258) | 186258..187715 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T265298 WP_000031108.1 NZ_CP113047:c183007-182855 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT265298 WP_001251224.1 NZ_CP113047:c183631-183032 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|