265282

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1762881..1763358 Replicon chromosome
Accession NZ_CP113042
Organism Staphylococcus aureus strain Seraphine

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS079_RS08830 Protein ID WP_000052078.1
Coordinates 1762881..1763069 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS079_RS08835 Protein ID WP_001059690.1
Coordinates 1763098..1763358 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS079_RS08800 (1758922) 1758922..1759392 + 471 WP_000824472.1 hypothetical protein -
OS079_RS08805 (1759733) 1759733..1760419 + 687 WP_001548082.1 thermonuclease family protein -
OS079_RS08810 (1760776) 1760776..1760976 + 201 WP_001059082.1 cold-shock protein -
OS079_RS08815 (1761472) 1761472..1761690 - 219 WP_000005886.1 hypothetical protein -
OS079_RS08820 (1761752) 1761752..1762036 - 285 WP_001004395.1 hypothetical protein -
OS079_RS08825 (1762124) 1762124..1762693 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS079_RS08830 (1762881) 1762881..1763069 - 189 WP_000052078.1 hypothetical protein Toxin
OS079_RS08835 (1763098) 1763098..1763358 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS079_RS08840 (1763699) 1763699..1763902 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS079_RS08845 (1763899) 1763899..1764135 - 237 WP_000368687.1 hypothetical protein -
OS079_RS08850 (1764360) 1764360..1764941 + 582 WP_001140686.1 histidine phosphatase family protein -
OS079_RS08855 (1765014) 1765014..1765631 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS079_RS08860 (1765786) 1765786..1766280 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS079_RS08865 (1766679) 1766679..1767101 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS079_RS08870 (1767249) 1767249..1767965 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 1757565..1788647 31082


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265282 WP_000052078.1 NZ_CP113042:c1763069-1762881 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265282 WP_001059690.1 NZ_CP113042:c1763358-1763098 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References