Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2006742..2007271 Replicon chromosome
Accession NZ_CP113039
Organism Staphylococcus aureus strain Gwen

Toxin (Protein)


Gene name TscT Uniprot ID -
Locus tag OS086_RS10100 Protein ID WP_267811006.1
Coordinates 2006954..2007271 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID A0A6B0BJC0
Locus tag OS086_RS10095 Protein ID WP_001058487.1
Coordinates 2006742..2006951 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS086_RS10060 (2003193) 2003193..2003657 + 465 WP_001085183.1 SsrA-binding protein SmpB -
OS086_RS10070 (2004220) 2004220..2005326 - 1107 WP_000121223.1 tyrosine-type recombinase/integrase -
OS086_RS10075 (2005332) 2005332..2005916 - 585 WP_000390814.1 helix-turn-helix transcriptional regulator -
OS086_RS10080 (2006137) 2006137..2006343 + 207 WP_001060953.1 hypothetical protein -
OS086_RS10085 (2006379) 2006379..2006606 + 228 WP_000164237.1 helix-turn-helix transcriptional regulator -
OS086_RS10090 (2006603) 2006603..2006749 + 147 WP_000784893.1 hypothetical protein -
OS086_RS10095 (2006742) 2006742..2006951 + 210 WP_001058487.1 hypothetical protein Antitoxin
OS086_RS10100 (2006954) 2006954..2007271 + 318 WP_267811006.1 DUF1474 family protein Toxin
OS086_RS10105 (2007338) 2007338..2008207 + 870 WP_001002695.1 primase alpha helix C-terminal domain-containing protein -
OS086_RS10110 (2008224) 2008224..2009693 + 1470 WP_001668899.1 virulence-associated E family protein -
OS086_RS10115 (2009979) 2009979..2010341 + 363 WP_001039169.1 hypothetical protein -
OS086_RS10120 (2010343) 2010343..2010627 + 285 WP_000998179.1 hypothetical protein -
OS086_RS10125 (2010624) 2010624..2011265 + 642 WP_001019810.1 hypothetical protein -
OS086_RS10130 (2011715) 2011715..2012056 + 342 WP_001190615.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2000799..2016034 15235


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12510.19 Da        Isoelectric Point: 4.8672

>T265267 WP_267811006.1 NZ_CP113039:2006954-2007271 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKKKINDVAIKHGWFVEDKFVKNELETKQEHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASSENFGEESDDAKKLKITE

Download         Length: 318 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8228.24 Da        Isoelectric Point: 4.1682

>AT265267 WP_001058487.1 NZ_CP113039:2006742-2006951 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSIMNNFESYEHTEYVDGIEVVSEISPEKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6B0BJC0

References