Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 444749..445278 | Replicon | chromosome |
Accession | NZ_CP113039 | ||
Organism | Staphylococcus aureus strain Gwen |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS086_RS02460 | Protein ID | WP_000621175.1 |
Coordinates | 444749..445111 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS086_RS02465 | Protein ID | WP_000948331.1 |
Coordinates | 445108..445278 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS086_RS02440 (441727) | 441727..442497 | - | 771 | WP_001041111.1 | RNA polymerase sigma factor SigB | - |
OS086_RS02445 (442472) | 442472..442951 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
OS086_RS02450 (442953) | 442953..443279 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS086_RS02455 (443398) | 443398..444399 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS086_RS02460 (444749) | 444749..445111 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS086_RS02465 (445108) | 445108..445278 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS086_RS02470 (445363) | 445363..446511 | - | 1149 | WP_001281154.1 | alanine racemase | - |
OS086_RS02475 (446577) | 446577..446936 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
OS086_RS02480 (446940) | 446940..447431 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
OS086_RS02485 (447418) | 447418..449001 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
OS086_RS02490 (448994) | 448994..449473 | - | 480 | WP_001287087.1 | hypothetical protein | - |
OS086_RS02495 (449681) | 449681..450241 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265260 WP_000621175.1 NZ_CP113039:c445111-444749 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|