Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2402690..2403222 Replicon chromosome
Accession NZ_CP113037
Organism Staphylococcus aureus strain Zilean

Toxin (Protein)


Gene name TscT Uniprot ID -
Locus tag OS091_RS12305 Protein ID WP_267841959.1
Coordinates 2402690..2403010 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag OS091_RS12310 Protein ID WP_001058492.1
Coordinates 2403013..2403222 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS091_RS12280 2398696..2399337 - 642 WP_001019807.1 hypothetical protein -
OS091_RS12285 2399334..2399618 - 285 WP_000998185.1 hypothetical protein -
OS091_RS12290 2399620..2399982 - 363 WP_001039170.1 hypothetical protein -
OS091_RS12295 2400283..2401740 - 1458 WP_000390453.1 virulence-associated E family protein -
OS091_RS12300 2401757..2402626 - 870 WP_001002717.1 primase alpha helix C-terminal domain-containing protein -
OS091_RS12305 2402690..2403010 - 321 WP_267841959.1 DUF1474 family protein Toxin
OS091_RS12310 2403013..2403222 - 210 WP_001058492.1 hypothetical protein Antitoxin
OS091_RS12315 2403215..2403361 - 147 WP_000784885.1 hypothetical protein -
OS091_RS12320 2403373..2403591 - 219 WP_000163544.1 helix-turn-helix transcriptional regulator -
OS091_RS12325 2403627..2403830 - 204 WP_001045296.1 transcriptional regulator -
OS091_RS12330 2404119..2404772 + 654 WP_000026883.1 hypothetical protein -
OS091_RS12335 2404762..2405868 + 1107 WP_000149511.1 tyrosine-type recombinase/integrase -
OS091_RS12345 2406431..2406895 - 465 WP_001085185.1 SsrA-binding protein SmpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / sell / sell / sec 2372622..2405868 33246


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12634.25 Da        Isoelectric Point: 5.0161

>T265253 WP_267841959.1 NZ_CP113037:c2403010-2402690 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKSIKITE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT265253 WP_001058492.1 NZ_CP113037:c2403222-2403013 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References