Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 2402690..2403222 | Replicon | chromosome |
| Accession | NZ_CP113037 | ||
| Organism | Staphylococcus aureus strain Zilean | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | - |
| Locus tag | OS091_RS12305 | Protein ID | WP_267841959.1 |
| Coordinates | 2402690..2403010 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IA75 |
| Locus tag | OS091_RS12310 | Protein ID | WP_001058492.1 |
| Coordinates | 2403013..2403222 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS091_RS12280 | 2398696..2399337 | - | 642 | WP_001019807.1 | hypothetical protein | - |
| OS091_RS12285 | 2399334..2399618 | - | 285 | WP_000998185.1 | hypothetical protein | - |
| OS091_RS12290 | 2399620..2399982 | - | 363 | WP_001039170.1 | hypothetical protein | - |
| OS091_RS12295 | 2400283..2401740 | - | 1458 | WP_000390453.1 | virulence-associated E family protein | - |
| OS091_RS12300 | 2401757..2402626 | - | 870 | WP_001002717.1 | primase alpha helix C-terminal domain-containing protein | - |
| OS091_RS12305 | 2402690..2403010 | - | 321 | WP_267841959.1 | DUF1474 family protein | Toxin |
| OS091_RS12310 | 2403013..2403222 | - | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
| OS091_RS12315 | 2403215..2403361 | - | 147 | WP_000784885.1 | hypothetical protein | - |
| OS091_RS12320 | 2403373..2403591 | - | 219 | WP_000163544.1 | helix-turn-helix transcriptional regulator | - |
| OS091_RS12325 | 2403627..2403830 | - | 204 | WP_001045296.1 | transcriptional regulator | - |
| OS091_RS12330 | 2404119..2404772 | + | 654 | WP_000026883.1 | hypothetical protein | - |
| OS091_RS12335 | 2404762..2405868 | + | 1107 | WP_000149511.1 | tyrosine-type recombinase/integrase | - |
| OS091_RS12345 | 2406431..2406895 | - | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | vWbp / sell / sell / sec | 2372622..2405868 | 33246 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12634.25 Da Isoelectric Point: 5.0161
>T265253 WP_267841959.1 NZ_CP113037:c2403010-2402690 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKSIKITE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKSIKITE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|