Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2375545..2376022 Replicon chromosome
Accession NZ_CP113037
Organism Staphylococcus aureus strain Zilean

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag OS091_RS12150 Protein ID WP_000052076.1
Coordinates 2375834..2376022 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS091_RS12145 Protein ID WP_001059690.1
Coordinates 2375545..2375805 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS091_RS12110 2370937..2371653 - 717 WP_000150029.1 type I 3-dehydroquinate dehydratase -
OS091_RS12115 2371801..2372223 + 423 WP_000974455.1 organic hydroperoxide resistance protein -
OS091_RS12120 2372622..2373116 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
OS091_RS12125 2373272..2373889 + 618 WP_000255554.1 LysE/ArgO family amino acid transporter -
OS091_RS12130 2373962..2374543 - 582 WP_001140697.1 histidine phosphatase family protein -
OS091_RS12135 2374768..2375004 + 237 WP_000368687.1 hypothetical protein -
OS091_RS12140 2375001..2375204 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS091_RS12145 2375545..2375805 + 261 WP_001059690.1 hypothetical protein Antitoxin
OS091_RS12150 2375834..2376022 + 189 WP_000052076.1 hypothetical protein Toxin
OS091_RS12155 2376210..2376779 + 570 WP_001106657.1 lipoprotein N-acylation protein LnsA -
OS091_RS12160 2376867..2377151 + 285 WP_001004397.1 hypothetical protein -
OS091_RS12165 2377213..2377431 + 219 WP_000005888.1 hypothetical protein -
OS091_RS12170 2377930..2378130 - 201 WP_001059082.1 cold-shock protein -
OS091_RS12175 2378487..2379173 - 687 WP_001823812.1 thermonuclease family protein -
OS091_RS12180 2379514..2379984 - 471 WP_000824462.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / sell / sell / sec 2372622..2405868 33246


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T265252 WP_000052076.1 NZ_CP113037:2375834-2376022 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265252 WP_001059690.1 NZ_CP113037:2375545-2375805 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References