Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1109474..1110003 | Replicon | chromosome |
Accession | NZ_CP113037 | ||
Organism | Staphylococcus aureus strain Zilean |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS091_RS05670 | Protein ID | WP_000621175.1 |
Coordinates | 1109641..1110003 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS091_RS05665 | Protein ID | WP_000948331.1 |
Coordinates | 1109474..1109644 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS091_RS05635 | 1104510..1105070 | + | 561 | WP_001092405.1 | K(+)-transporting ATPase subunit C | - |
OS091_RS05640 | 1105279..1105758 | + | 480 | WP_267842146.1 | hypothetical protein | - |
OS091_RS05645 | 1105751..1107334 | + | 1584 | WP_001294642.1 | PH domain-containing protein | - |
OS091_RS05650 | 1107321..1107812 | + | 492 | WP_001205915.1 | PH domain-containing protein | - |
OS091_RS05655 | 1107816..1108175 | + | 360 | WP_000581194.1 | holo-ACP synthase | - |
OS091_RS05660 | 1108241..1109389 | + | 1149 | WP_001280702.1 | alanine racemase | - |
OS091_RS05665 | 1109474..1109644 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS091_RS05670 | 1109641..1110003 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS091_RS05675 | 1110352..1111353 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS091_RS05680 | 1111472..1111798 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS091_RS05685 | 1111800..1112279 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
OS091_RS05690 | 1112254..1113024 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265248 WP_000621175.1 NZ_CP113037:1109641-1110003 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|