Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 543413..544521 | Replicon | chromosome |
Accession | NZ_CP113037 | ||
Organism | Staphylococcus aureus strain Zilean |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | OS091_RS02800 | Protein ID | WP_000233000.1 |
Coordinates | 543652..544521 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | OS091_RS02795 | Protein ID | WP_000205227.1 |
Coordinates | 543413..543637 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS091_RS02765 | 539002..539172 | + | 171 | WP_000713595.1 | hypothetical protein | - |
OS091_RS02770 | 539186..539804 | + | 619 | Protein_476 | recombinase family protein | - |
OS091_RS02775 | 539804..540481 | + | 678 | Protein_477 | DNA topoisomerase | - |
OS091_RS02780 | 540963..541289 | + | 327 | WP_000392725.1 | hypothetical protein | - |
OS091_RS02785 | 541290..541706 | + | 417 | WP_000323438.1 | recombinase | - |
OS091_RS02790 | 541726..543270 | + | 1545 | WP_002390960.1 | recombinase family protein | - |
OS091_RS02795 | 543413..543637 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OS091_RS02800 | 543652..544521 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
OS091_RS02805 | 544502..545236 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
OS091_RS02810 | 545269..546177 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
OS091_RS02815 | 546174..546654 | + | 481 | Protein_485 | GNAT family N-acetyltransferase | - |
OS091_RS02820 | 546747..547541 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
OS091_RS02825 | 548083..548166 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
OS091_RS02830 | 548291..549028 | + | 738 | WP_001038790.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | ant(6)-Ia / aph(3')-III / erm(B) | - | 537999..553944 | 15945 | |
- | flank | IS/Tn | ant(6)-Ia / aph(3')-III / erm(B) | - | 545269..553944 | 8675 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T265241 WP_000233000.1 NZ_CP113037:543652-544521 [Staphylococcus aureus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|