Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2239516..2240045 | Replicon | chromosome |
Accession | NZ_CP113032 | ||
Organism | Staphylococcus aureus strain Akali |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS080_RS11705 | Protein ID | WP_000621175.1 |
Coordinates | 2239516..2239878 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS080_RS11710 | Protein ID | WP_000948331.1 |
Coordinates | 2239875..2240045 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS080_RS11685 (2236495) | 2236495..2237265 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
OS080_RS11690 (2237240) | 2237240..2237719 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
OS080_RS11695 (2237721) | 2237721..2238047 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS080_RS11700 (2238166) | 2238166..2239167 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS080_RS11705 (2239516) | 2239516..2239878 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS080_RS11710 (2239875) | 2239875..2240045 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS080_RS11715 (2240130) | 2240130..2241278 | - | 1149 | WP_001281145.1 | alanine racemase | - |
OS080_RS11720 (2241344) | 2241344..2241703 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
OS080_RS11725 (2241707) | 2241707..2242198 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
OS080_RS11730 (2242185) | 2242185..2243768 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
OS080_RS11735 (2243761) | 2243761..2244240 | - | 480 | WP_001287088.1 | hypothetical protein | - |
OS080_RS11740 (2244448) | 2244448..2245008 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265233 WP_000621175.1 NZ_CP113032:c2239878-2239516 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|