Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-doc |
| Location | 2174329..2174954 | Replicon | chromosome |
| Accession | NZ_CP113032 | ||
| Organism | Staphylococcus aureus strain Akali | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A380FZ43 |
| Locus tag | OS080_RS11295 | Protein ID | WP_001179607.1 |
| Coordinates | 2174329..2174724 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A380FXS4 |
| Locus tag | OS080_RS11300 | Protein ID | WP_000258939.1 |
| Coordinates | 2174724..2174954 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS080_RS11255 (2169884) | 2169884..2170324 | - | 441 | Protein_2158 | GNAT family N-acetyltransferase | - |
| OS080_RS11260 (2170299) | 2170299..2170538 | - | 240 | WP_232727579.1 | streptothricin acetyltransferase | - |
| OS080_RS11265 (2170547) | 2170547..2171182 | - | 636 | Protein_2160 | aminoglycoside 6-adenylyltransferase | - |
| OS080_RS11270 (2171397) | 2171397..2172119 | - | 723 | WP_001043218.1 | hypothetical protein | - |
| OS080_RS11275 (2172228) | 2172228..2173028 | - | 801 | WP_000686449.1 | metallophosphoesterase | - |
| OS080_RS11280 (2173032) | 2173032..2173526 | - | 495 | WP_000280790.1 | hypothetical protein | - |
| OS080_RS11285 (2173583) | 2173583..2173819 | - | 237 | WP_224757061.1 | hypothetical protein | - |
| OS080_RS11290 (2173836) | 2173836..2174276 | - | 441 | WP_000889963.1 | hypothetical protein | - |
| OS080_RS11295 (2174329) | 2174329..2174724 | - | 396 | WP_001179607.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OS080_RS11300 (2174724) | 2174724..2174954 | - | 231 | WP_000258939.1 | addiction module antitoxin | Antitoxin |
| OS080_RS11305 (2175130) | 2175130..2175651 | - | 522 | WP_000639078.1 | metallophosphoesterase | - |
| OS080_RS11310 (2175651) | 2175651..2176301 | - | 651 | WP_000411528.1 | hypothetical protein | - |
| OS080_RS11315 (2176301) | 2176301..2176618 | - | 318 | WP_001807410.1 | hypothetical protein | - |
| OS080_RS11320 (2176611) | 2176611..2177336 | - | 726 | WP_000197304.1 | fructose-bisphosphatase class III | - |
| OS080_RS11325 (2177336) | 2177336..2177557 | - | 222 | WP_000829423.1 | hypothetical protein | - |
| OS080_RS11330 (2177577) | 2177577..2177762 | - | 186 | WP_129760514.1 | hypothetical protein | - |
| OS080_RS11335 (2177746) | 2177746..2178288 | - | 543 | WP_000858632.1 | hypothetical protein | - |
| OS080_RS11340 (2178303) | 2178303..2178575 | - | 273 | WP_000691100.1 | hypothetical protein | - |
| OS080_RS11345 (2178601) | 2178601..2178756 | - | 156 | WP_000792995.1 | transcriptional regulator | - |
| OS080_RS11350 (2178870) | 2178870..2179037 | - | 168 | WP_000312832.1 | hypothetical protein | - |
| OS080_RS11355 (2179053) | 2179053..2179238 | - | 186 | WP_001187008.1 | hypothetical protein | - |
| OS080_RS11360 (2179223) | 2179223..2179402 | - | 180 | WP_000401832.1 | hypothetical protein | - |
| OS080_RS11365 (2179416) | 2179416..2179898 | - | 483 | WP_000833764.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2171397..2211229 | 39832 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 15035.51 Da Isoelectric Point: 9.4574
>T265232 WP_001179607.1 NZ_CP113032:c2174724-2174329 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380FZ43 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380FXS4 |