Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 2174329..2174954 Replicon chromosome
Accession NZ_CP113032
Organism Staphylococcus aureus strain Akali

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag OS080_RS11295 Protein ID WP_001179607.1
Coordinates 2174329..2174724 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag OS080_RS11300 Protein ID WP_000258939.1
Coordinates 2174724..2174954 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS080_RS11255 (2169884) 2169884..2170324 - 441 Protein_2158 GNAT family N-acetyltransferase -
OS080_RS11260 (2170299) 2170299..2170538 - 240 WP_232727579.1 streptothricin acetyltransferase -
OS080_RS11265 (2170547) 2170547..2171182 - 636 Protein_2160 aminoglycoside 6-adenylyltransferase -
OS080_RS11270 (2171397) 2171397..2172119 - 723 WP_001043218.1 hypothetical protein -
OS080_RS11275 (2172228) 2172228..2173028 - 801 WP_000686449.1 metallophosphoesterase -
OS080_RS11280 (2173032) 2173032..2173526 - 495 WP_000280790.1 hypothetical protein -
OS080_RS11285 (2173583) 2173583..2173819 - 237 WP_224757061.1 hypothetical protein -
OS080_RS11290 (2173836) 2173836..2174276 - 441 WP_000889963.1 hypothetical protein -
OS080_RS11295 (2174329) 2174329..2174724 - 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OS080_RS11300 (2174724) 2174724..2174954 - 231 WP_000258939.1 addiction module antitoxin Antitoxin
OS080_RS11305 (2175130) 2175130..2175651 - 522 WP_000639078.1 metallophosphoesterase -
OS080_RS11310 (2175651) 2175651..2176301 - 651 WP_000411528.1 hypothetical protein -
OS080_RS11315 (2176301) 2176301..2176618 - 318 WP_001807410.1 hypothetical protein -
OS080_RS11320 (2176611) 2176611..2177336 - 726 WP_000197304.1 fructose-bisphosphatase class III -
OS080_RS11325 (2177336) 2177336..2177557 - 222 WP_000829423.1 hypothetical protein -
OS080_RS11330 (2177577) 2177577..2177762 - 186 WP_129760514.1 hypothetical protein -
OS080_RS11335 (2177746) 2177746..2178288 - 543 WP_000858632.1 hypothetical protein -
OS080_RS11340 (2178303) 2178303..2178575 - 273 WP_000691100.1 hypothetical protein -
OS080_RS11345 (2178601) 2178601..2178756 - 156 WP_000792995.1 transcriptional regulator -
OS080_RS11350 (2178870) 2178870..2179037 - 168 WP_000312832.1 hypothetical protein -
OS080_RS11355 (2179053) 2179053..2179238 - 186 WP_001187008.1 hypothetical protein -
OS080_RS11360 (2179223) 2179223..2179402 - 180 WP_000401832.1 hypothetical protein -
OS080_RS11365 (2179416) 2179416..2179898 - 483 WP_000833764.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2171397..2211229 39832


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T265232 WP_001179607.1 NZ_CP113032:c2174724-2174329 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT265232 WP_000258939.1 NZ_CP113032:c2174954-2174724 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References