Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1967111..1967887 | Replicon | chromosome |
Accession | NZ_CP113032 | ||
Organism | Staphylococcus aureus strain Akali |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | OS080_RS09895 | Protein ID | WP_000031108.1 |
Coordinates | 1967111..1967263 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | OS080_RS09900 | Protein ID | WP_001251224.1 |
Coordinates | 1967288..1967887 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS080_RS09880 (1963074) | 1963074..1963895 | + | 822 | WP_000669375.1 | RluA family pseudouridine synthase | - |
OS080_RS09885 (1964358) | 1964358..1965743 | - | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
OS080_RS09890 (1965939) | 1965939..1966334 | - | 396 | WP_000901021.1 | hypothetical protein | - |
OS080_RS09895 (1967111) | 1967111..1967263 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
OS080_RS09900 (1967288) | 1967288..1967887 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
OS080_RS09905 (1968046) | 1968046..1968516 | - | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
OS080_RS09910 (1968521) | 1968521..1969648 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
OS080_RS09915 (1969799) | 1969799..1970521 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
OS080_RS09920 (1970514) | 1970514..1971971 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T265228 WP_000031108.1 NZ_CP113032:c1967263-1967111 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT265228 WP_001251224.1 NZ_CP113032:c1967887-1967288 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|