Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1108347..1109147 Replicon chromosome
Accession NZ_CP113032
Organism Staphylococcus aureus strain Akali

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag OS080_RS05685 Protein ID WP_172844569.1
Coordinates 1108347..1108811 (-) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag OS080_RS05690 Protein ID WP_001260487.1
Coordinates 1108824..1109147 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS080_RS05660 (1103850) 1103850..1104989 - 1140 WP_000843599.1 nucleotidyltransferase -
OS080_RS05665 (1105116) 1105116..1105673 + 558 WP_000872158.1 DUF177 domain-containing protein -
OS080_RS05670 (1105753) 1105753..1105926 + 174 WP_000290472.1 50S ribosomal protein L32 -
OS080_RS05675 (1106043) 1106043..1107428 - 1386 WP_172844568.1 recombinase family protein -
OS080_RS05680 (1107635) 1107635..1108315 - 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
OS080_RS05685 (1108347) 1108347..1108811 - 465 WP_172844569.1 toxin Toxin
OS080_RS05690 (1108824) 1108824..1109147 - 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
OS080_RS05695 (1109311) 1109311..1109559 + 249 WP_000272859.1 helix-turn-helix transcriptional regulator -
OS080_RS05700 (1109572) 1109572..1110018 + 447 WP_031767740.1 hypothetical protein -
OS080_RS05705 (1110033) 1110033..1110176 + 144 WP_000939498.1 hypothetical protein -
OS080_RS05710 (1110166) 1110166..1110375 - 210 WP_000642492.1 hypothetical protein -
OS080_RS05715 (1110432) 1110432..1111211 + 780 WP_072466105.1 phage antirepressor KilAC domain-containing protein -
OS080_RS05720 (1111212) 1111212..1111436 + 225 WP_000187184.1 hypothetical protein -
OS080_RS05725 (1111476) 1111476..1111652 + 177 WP_172844570.1 hypothetical protein -
OS080_RS05730 (1111627) 1111627..1111857 - 231 WP_000395457.1 hypothetical protein -
OS080_RS05735 (1111916) 1111916..1112044 + 129 WP_001559112.1 hypothetical protein -
OS080_RS05740 (1112037) 1112037..1112198 + 162 WP_001619936.1 DUF1270 family protein -
OS080_RS05745 (1112290) 1112290..1112550 + 261 WP_000291089.1 DUF1108 family protein -
OS080_RS05750 (1112563) 1112563..1113099 + 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
OS080_RS05755 (1113100) 1113100..1113747 + 648 WP_267841519.1 ERF family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1106043..1147859 41816


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18184.58 Da        Isoelectric Point: 4.7927

>T265226 WP_172844569.1 NZ_CP113032:c1108811-1108347 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREVDVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT265226 WP_001260487.1 NZ_CP113032:c1109147-1108824 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References