Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1108347..1109147 | Replicon | chromosome |
| Accession | NZ_CP113032 | ||
| Organism | Staphylococcus aureus strain Akali | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OS080_RS05685 | Protein ID | WP_172844569.1 |
| Coordinates | 1108347..1108811 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0C2LD36 |
| Locus tag | OS080_RS05690 | Protein ID | WP_001260487.1 |
| Coordinates | 1108824..1109147 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS080_RS05660 (1103850) | 1103850..1104989 | - | 1140 | WP_000843599.1 | nucleotidyltransferase | - |
| OS080_RS05665 (1105116) | 1105116..1105673 | + | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| OS080_RS05670 (1105753) | 1105753..1105926 | + | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| OS080_RS05675 (1106043) | 1106043..1107428 | - | 1386 | WP_172844568.1 | recombinase family protein | - |
| OS080_RS05680 (1107635) | 1107635..1108315 | - | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| OS080_RS05685 (1108347) | 1108347..1108811 | - | 465 | WP_172844569.1 | toxin | Toxin |
| OS080_RS05690 (1108824) | 1108824..1109147 | - | 324 | WP_001260487.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OS080_RS05695 (1109311) | 1109311..1109559 | + | 249 | WP_000272859.1 | helix-turn-helix transcriptional regulator | - |
| OS080_RS05700 (1109572) | 1109572..1110018 | + | 447 | WP_031767740.1 | hypothetical protein | - |
| OS080_RS05705 (1110033) | 1110033..1110176 | + | 144 | WP_000939498.1 | hypothetical protein | - |
| OS080_RS05710 (1110166) | 1110166..1110375 | - | 210 | WP_000642492.1 | hypothetical protein | - |
| OS080_RS05715 (1110432) | 1110432..1111211 | + | 780 | WP_072466105.1 | phage antirepressor KilAC domain-containing protein | - |
| OS080_RS05720 (1111212) | 1111212..1111436 | + | 225 | WP_000187184.1 | hypothetical protein | - |
| OS080_RS05725 (1111476) | 1111476..1111652 | + | 177 | WP_172844570.1 | hypothetical protein | - |
| OS080_RS05730 (1111627) | 1111627..1111857 | - | 231 | WP_000395457.1 | hypothetical protein | - |
| OS080_RS05735 (1111916) | 1111916..1112044 | + | 129 | WP_001559112.1 | hypothetical protein | - |
| OS080_RS05740 (1112037) | 1112037..1112198 | + | 162 | WP_001619936.1 | DUF1270 family protein | - |
| OS080_RS05745 (1112290) | 1112290..1112550 | + | 261 | WP_000291089.1 | DUF1108 family protein | - |
| OS080_RS05750 (1112563) | 1112563..1113099 | + | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| OS080_RS05755 (1113100) | 1113100..1113747 | + | 648 | WP_267841519.1 | ERF family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1106043..1147859 | 41816 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18184.58 Da Isoelectric Point: 4.7927
>T265226 WP_172844569.1 NZ_CP113032:c1108811-1108347 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREVDVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID
MGLYEETLIQHDYIEIREVDVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|