Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 869604..870109 | Replicon | chromosome |
| Accession | NZ_CP113032 | ||
| Organism | Staphylococcus aureus strain Akali | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A0C6E6D5 |
| Locus tag | OS080_RS04480 | Protein ID | WP_001103946.1 |
| Coordinates | 869816..870109 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IA75 |
| Locus tag | OS080_RS04475 | Protein ID | WP_001058492.1 |
| Coordinates | 869604..869813 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS080_RS04440 (865121) | 865121..866341 | - | 1221 | WP_000264182.1 | site-specific integrase | - |
| OS080_RS04445 (866429) | 866429..867157 | - | 729 | WP_000733773.1 | staphylococcal enterotoxin type K | - |
| OS080_RS04450 (867181) | 867181..867909 | - | 729 | WP_001033317.1 | staphylococcal enterotoxin type Q | - |
| OS080_RS04455 (868084) | 868084..868818 | - | 735 | WP_000142630.1 | helix-turn-helix transcriptional regulator | - |
| OS080_RS04460 (868968) | 868968..869180 | + | 213 | WP_001063624.1 | helix-turn-helix transcriptional regulator | - |
| OS080_RS04465 (869181) | 869181..869453 | + | 273 | WP_001138298.1 | helix-turn-helix domain-containing protein | - |
| OS080_RS04470 (869465) | 869465..869611 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| OS080_RS04475 (869604) | 869604..869813 | + | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
| OS080_RS04480 (869816) | 869816..870109 | + | 294 | WP_001103946.1 | DUF1474 family protein | Toxin |
| OS080_RS04485 (870197) | 870197..871066 | + | 870 | WP_267841503.1 | primase alpha helix C-terminal domain-containing protein | - |
| OS080_RS04490 (871083) | 871083..872540 | + | 1458 | WP_000432707.1 | virulence-associated E family protein | - |
| OS080_RS04495 (872842) | 872842..873204 | + | 363 | WP_001039172.1 | hypothetical protein | - |
| OS080_RS04500 (873206) | 873206..873490 | + | 285 | WP_000998180.1 | hypothetical protein | - |
| OS080_RS04505 (873487) | 873487..874128 | + | 642 | WP_267793744.1 | pathogenicity island protein | - |
| OS080_RS04510 (874577) | 874577..874918 | + | 342 | WP_001190616.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk / selq | 847171..877232 | 30061 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11590.08 Da Isoelectric Point: 4.9594
>T265225 WP_001103946.1 NZ_CP113032:869816-870109 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C6E6D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | X5IA75 |