265225

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 869604..870109 Replicon chromosome
Accession NZ_CP113032
Organism Staphylococcus aureus strain Akali

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag OS080_RS04480 Protein ID WP_001103946.1
Coordinates 869816..870109 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag OS080_RS04475 Protein ID WP_001058492.1
Coordinates 869604..869813 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS080_RS04440 (865121) 865121..866341 - 1221 WP_000264182.1 site-specific integrase -
OS080_RS04445 (866429) 866429..867157 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
OS080_RS04450 (867181) 867181..867909 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
OS080_RS04455 (868084) 868084..868818 - 735 WP_000142630.1 helix-turn-helix transcriptional regulator -
OS080_RS04460 (868968) 868968..869180 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
OS080_RS04465 (869181) 869181..869453 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
OS080_RS04470 (869465) 869465..869611 + 147 WP_000784885.1 hypothetical protein -
OS080_RS04475 (869604) 869604..869813 + 210 WP_001058492.1 hypothetical protein Antitoxin
OS080_RS04480 (869816) 869816..870109 + 294 WP_001103946.1 DUF1474 family protein Toxin
OS080_RS04485 (870197) 870197..871066 + 870 WP_267841503.1 primase alpha helix C-terminal domain-containing protein -
OS080_RS04490 (871083) 871083..872540 + 1458 WP_000432707.1 virulence-associated E family protein -
OS080_RS04495 (872842) 872842..873204 + 363 WP_001039172.1 hypothetical protein -
OS080_RS04500 (873206) 873206..873490 + 285 WP_000998180.1 hypothetical protein -
OS080_RS04505 (873487) 873487..874128 + 642 WP_267793744.1 pathogenicity island protein -
OS080_RS04510 (874577) 874577..874918 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 847171..877232 30061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T265225 WP_001103946.1 NZ_CP113032:869816-870109 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT265225 WP_001058492.1 NZ_CP113032:869604-869813 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References