Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 852487..852964 Replicon chromosome
Accession NZ_CP113032
Organism Staphylococcus aureus strain Akali

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS080_RS04345 Protein ID WP_000052078.1
Coordinates 852487..852675 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS080_RS04350 Protein ID WP_001059690.1
Coordinates 852704..852964 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS080_RS04315 (848528) 848528..848998 + 471 WP_000824472.1 hypothetical protein -
OS080_RS04320 (849339) 849339..850025 + 687 WP_001548082.1 thermonuclease family protein -
OS080_RS04325 (850382) 850382..850582 + 201 WP_001059082.1 cold-shock protein -
OS080_RS04330 (851078) 851078..851296 - 219 WP_000005886.1 hypothetical protein -
OS080_RS04335 (851358) 851358..851642 - 285 WP_001004395.1 hypothetical protein -
OS080_RS04340 (851730) 851730..852299 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS080_RS04345 (852487) 852487..852675 - 189 WP_000052078.1 hypothetical protein Toxin
OS080_RS04350 (852704) 852704..852964 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS080_RS04355 (853305) 853305..853508 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS080_RS04360 (853505) 853505..853741 - 237 WP_000368687.1 hypothetical protein -
OS080_RS04365 (853966) 853966..854547 + 582 WP_001140686.1 histidine phosphatase family protein -
OS080_RS04370 (854620) 854620..855237 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS080_RS04375 (855392) 855392..855886 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS080_RS04380 (856285) 856285..856707 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS080_RS04385 (856855) 856855..857571 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 847171..877232 30061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265224 WP_000052078.1 NZ_CP113032:c852675-852487 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265224 WP_001059690.1 NZ_CP113032:c852964-852704 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References