Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2536605..2537082 Replicon chromosome
Accession NZ_CP113029
Organism Staphylococcus aureus strain Zoe

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS075_RS13035 Protein ID WP_000052078.1
Coordinates 2536894..2537082 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS075_RS13030 Protein ID WP_001059690.1
Coordinates 2536605..2536865 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS075_RS12995 (2531998) 2531998..2532714 - 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -
OS075_RS13000 (2532862) 2532862..2533284 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS075_RS13005 (2533683) 2533683..2534177 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS075_RS13010 (2534332) 2534332..2534949 + 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS075_RS13015 (2535022) 2535022..2535603 - 582 WP_001140686.1 histidine phosphatase family protein -
OS075_RS13020 (2535828) 2535828..2536064 + 237 WP_000368687.1 hypothetical protein -
OS075_RS13025 (2536061) 2536061..2536264 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS075_RS13030 (2536605) 2536605..2536865 + 261 WP_001059690.1 hypothetical protein Antitoxin
OS075_RS13035 (2536894) 2536894..2537082 + 189 WP_000052078.1 hypothetical protein Toxin
OS075_RS13040 (2537270) 2537270..2537839 + 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS075_RS13045 (2537927) 2537927..2538211 + 285 WP_001004395.1 hypothetical protein -
OS075_RS13050 (2538273) 2538273..2538491 + 219 WP_000005886.1 hypothetical protein -
OS075_RS13055 (2538987) 2538987..2539187 - 201 WP_001059082.1 cold-shock protein -
OS075_RS13060 (2539544) 2539544..2540230 - 687 WP_001548082.1 thermonuclease family protein -
OS075_RS13065 (2540571) 2540571..2541041 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265223 WP_000052078.1 NZ_CP113029:2536894-2537082 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265223 WP_001059690.1 NZ_CP113029:2536605-2536865 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References