Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2514013..2514804 | Replicon | chromosome |
| Accession | NZ_CP113029 | ||
| Organism | Staphylococcus aureus strain Zoe | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OS075_RS12890 | Protein ID | WP_031783010.1 |
| Coordinates | 2514340..2514804 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | OS075_RS12885 | Protein ID | WP_000333630.1 |
| Coordinates | 2514013..2514327 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS075_RS12820 (2509022) | 2509022..2509696 | - | 675 | WP_020444663.1 | putative HNHc nuclease | - |
| OS075_RS12825 (2509710) | 2509710..2510138 | - | 429 | WP_089519264.1 | single-stranded DNA-binding protein | - |
| OS075_RS12830 (2510138) | 2510138..2510761 | - | 624 | WP_000139724.1 | DUF1071 domain-containing protein | - |
| OS075_RS12835 (2510754) | 2510754..2510975 | - | 222 | WP_000815401.1 | DUF2483 family protein | - |
| OS075_RS12840 (2510985) | 2510985..2511245 | - | 261 | WP_048657592.1 | DUF1108 family protein | - |
| OS075_RS12845 (2511337) | 2511337..2511498 | - | 162 | WP_000066019.1 | DUF1270 family protein | - |
| OS075_RS12850 (2511495) | 2511495..2511713 | - | 219 | WP_064135926.1 | hypothetical protein | - |
| OS075_RS12855 (2511727) | 2511727..2512176 | - | 450 | WP_000993183.1 | hypothetical protein | - |
| OS075_RS12860 (2512216) | 2512216..2512440 | - | 225 | WP_023604832.1 | hypothetical protein | - |
| OS075_RS12865 (2512441) | 2512441..2513220 | - | 780 | WP_029625612.1 | phage antirepressor KilAC domain-containing protein | - |
| OS075_RS12870 (2513277) | 2513277..2513411 | + | 135 | WP_001119050.1 | hypothetical protein | - |
| OS075_RS12875 (2513408) | 2513408..2513611 | - | 204 | WP_000394020.1 | hypothetical protein | - |
| OS075_RS12880 (2513625) | 2513625..2513861 | - | 237 | WP_001121116.1 | helix-turn-helix transcriptional regulator | - |
| OS075_RS12885 (2514013) | 2514013..2514327 | + | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OS075_RS12890 (2514340) | 2514340..2514804 | + | 465 | WP_031783010.1 | toxin | Toxin |
| OS075_RS12895 (2514836) | 2514836..2515741 | + | 906 | WP_089519263.1 | hypothetical protein | - |
| OS075_RS12900 (2515678) | 2515678..2515878 | - | 201 | WP_000143212.1 | excisionase | - |
| OS075_RS12905 (2515990) | 2515990..2517040 | + | 1051 | Protein_2482 | tyrosine-type recombinase/integrase | - |
| OS075_RS12910 (2517108) | 2517108..2518505 | - | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| OS075_RS12915 (2518656) | 2518656..2519120 | - | 465 | WP_001010508.1 | SUF system NifU family Fe-S cluster assembly protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2474059..2518505 | 44446 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18142.50 Da Isoelectric Point: 4.7927
>T265222 WP_031783010.1 NZ_CP113029:2514340-2514804 [Staphylococcus aureus]
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|