Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 2514013..2514804 Replicon chromosome
Accession NZ_CP113029
Organism Staphylococcus aureus strain Zoe

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag OS075_RS12890 Protein ID WP_031783010.1
Coordinates 2514340..2514804 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag OS075_RS12885 Protein ID WP_000333630.1
Coordinates 2514013..2514327 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS075_RS12820 (2509022) 2509022..2509696 - 675 WP_020444663.1 putative HNHc nuclease -
OS075_RS12825 (2509710) 2509710..2510138 - 429 WP_089519264.1 single-stranded DNA-binding protein -
OS075_RS12830 (2510138) 2510138..2510761 - 624 WP_000139724.1 DUF1071 domain-containing protein -
OS075_RS12835 (2510754) 2510754..2510975 - 222 WP_000815401.1 DUF2483 family protein -
OS075_RS12840 (2510985) 2510985..2511245 - 261 WP_048657592.1 DUF1108 family protein -
OS075_RS12845 (2511337) 2511337..2511498 - 162 WP_000066019.1 DUF1270 family protein -
OS075_RS12850 (2511495) 2511495..2511713 - 219 WP_064135926.1 hypothetical protein -
OS075_RS12855 (2511727) 2511727..2512176 - 450 WP_000993183.1 hypothetical protein -
OS075_RS12860 (2512216) 2512216..2512440 - 225 WP_023604832.1 hypothetical protein -
OS075_RS12865 (2512441) 2512441..2513220 - 780 WP_029625612.1 phage antirepressor KilAC domain-containing protein -
OS075_RS12870 (2513277) 2513277..2513411 + 135 WP_001119050.1 hypothetical protein -
OS075_RS12875 (2513408) 2513408..2513611 - 204 WP_000394020.1 hypothetical protein -
OS075_RS12880 (2513625) 2513625..2513861 - 237 WP_001121116.1 helix-turn-helix transcriptional regulator -
OS075_RS12885 (2514013) 2514013..2514327 + 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
OS075_RS12890 (2514340) 2514340..2514804 + 465 WP_031783010.1 toxin Toxin
OS075_RS12895 (2514836) 2514836..2515741 + 906 WP_089519263.1 hypothetical protein -
OS075_RS12900 (2515678) 2515678..2515878 - 201 WP_000143212.1 excisionase -
OS075_RS12905 (2515990) 2515990..2517040 + 1051 Protein_2482 tyrosine-type recombinase/integrase -
OS075_RS12910 (2517108) 2517108..2518505 - 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -
OS075_RS12915 (2518656) 2518656..2519120 - 465 WP_001010508.1 SUF system NifU family Fe-S cluster assembly protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2474059..2518505 44446


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18142.50 Da        Isoelectric Point: 4.7927

>T265222 WP_031783010.1 NZ_CP113029:2514340-2514804 [Staphylococcus aureus]
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT265222 WP_000333630.1 NZ_CP113029:2514013-2514327 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References