Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1402462..1403238 | Replicon | chromosome |
| Accession | NZ_CP113029 | ||
| Organism | Staphylococcus aureus strain Zoe | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | OS075_RS07340 | Protein ID | WP_000031108.1 |
| Coordinates | 1403086..1403238 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | OS075_RS07335 | Protein ID | WP_001251224.1 |
| Coordinates | 1402462..1403061 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS075_RS07315 (1398378) | 1398378..1399835 | + | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
| OS075_RS07320 (1399828) | 1399828..1400550 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| OS075_RS07325 (1400701) | 1400701..1401828 | + | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| OS075_RS07330 (1401833) | 1401833..1402303 | + | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| OS075_RS07335 (1402462) | 1402462..1403061 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| OS075_RS07340 (1403086) | 1403086..1403238 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| OS075_RS07345 (1404015) | 1404015..1404410 | + | 396 | WP_000901021.1 | hypothetical protein | - |
| OS075_RS07350 (1404606) | 1404606..1405991 | + | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
| OS075_RS07355 (1406454) | 1406454..1407275 | - | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T265220 WP_000031108.1 NZ_CP113029:1403086-1403238 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT265220 WP_001251224.1 NZ_CP113029:1402462-1403061 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|