Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1202012..1202541 | Replicon | chromosome |
Accession | NZ_CP113029 | ||
Organism | Staphylococcus aureus strain Zoe |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS075_RS06075 | Protein ID | WP_000621175.1 |
Coordinates | 1202179..1202541 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS075_RS06070 | Protein ID | WP_000948331.1 |
Coordinates | 1202012..1202182 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS075_RS06040 (1197049) | 1197049..1197609 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
OS075_RS06045 (1197817) | 1197817..1198296 | + | 480 | WP_001287088.1 | hypothetical protein | - |
OS075_RS06050 (1198289) | 1198289..1199872 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
OS075_RS06055 (1199859) | 1199859..1200350 | + | 492 | WP_001205910.1 | PH domain-containing protein | - |
OS075_RS06060 (1200354) | 1200354..1200713 | + | 360 | WP_000581200.1 | holo-ACP synthase | - |
OS075_RS06065 (1200779) | 1200779..1201927 | + | 1149 | WP_001281145.1 | alanine racemase | - |
OS075_RS06070 (1202012) | 1202012..1202182 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS075_RS06075 (1202179) | 1202179..1202541 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS075_RS06080 (1202891) | 1202891..1203892 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS075_RS06085 (1204011) | 1204011..1204337 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS075_RS06090 (1204339) | 1204339..1204818 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
OS075_RS06095 (1204793) | 1204793..1205563 | + | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265216 WP_000621175.1 NZ_CP113029:1202179-1202541 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|