Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2613119..2613596 Replicon chromosome
Accession NZ_CP113027
Organism Staphylococcus aureus strain Syndra

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag OS083_RS13590 Protein ID WP_000052076.1
Coordinates 2613408..2613596 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag OS083_RS13585 Protein ID WP_160199178.1
Coordinates 2613119..2613379 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS083_RS13550 (2608511) 2608511..2609227 - 717 WP_000150029.1 type I 3-dehydroquinate dehydratase -
OS083_RS13555 (2609375) 2609375..2609797 + 423 WP_000974455.1 organic hydroperoxide resistance protein -
OS083_RS13560 (2610196) 2610196..2610690 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
OS083_RS13565 (2610846) 2610846..2611463 + 618 WP_000255554.1 LysE/ArgO family amino acid transporter -
OS083_RS13570 (2611536) 2611536..2612117 - 582 WP_001140697.1 histidine phosphatase family protein -
OS083_RS13575 (2612342) 2612342..2612578 + 237 WP_000368687.1 hypothetical protein -
OS083_RS13580 (2612575) 2612575..2612778 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS083_RS13585 (2613119) 2613119..2613379 + 261 WP_160199178.1 hypothetical protein Antitoxin
OS083_RS13590 (2613408) 2613408..2613596 + 189 WP_000052076.1 hypothetical protein Toxin
OS083_RS13595 (2613784) 2613784..2614353 + 570 WP_001106657.1 lipoprotein N-acylation protein LnsA -
OS083_RS13600 (2614441) 2614441..2614725 + 285 WP_001004397.1 hypothetical protein -
OS083_RS13605 (2614787) 2614787..2615005 + 219 WP_000005888.1 hypothetical protein -
OS083_RS13610 (2615504) 2615504..2615704 - 201 WP_001059082.1 cold-shock protein -
OS083_RS13615 (2616061) 2616061..2616747 - 687 WP_001823812.1 thermonuclease family protein -
OS083_RS13620 (2617088) 2617088..2617558 - 471 WP_000824462.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - seb / selq / selk / vWbp 2535404..2631623 96219


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T265208 WP_000052076.1 NZ_CP113027:2613408-2613596 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9974.11 Da        Isoelectric Point: 4.0624

>AT265208 WP_160199178.1 NZ_CP113027:2613119-2613379 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWFLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure

References