Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2595368..2595900 Replicon chromosome
Accession NZ_CP113027
Organism Staphylococcus aureus strain Syndra

Toxin (Protein)


Gene name TscT Uniprot ID Q93CD4
Locus tag OS083_RS13445 Protein ID WP_001103942.1
Coordinates 2595368..2595688 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag OS083_RS13450 Protein ID WP_001058486.1
Coordinates 2595691..2595900 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS083_RS13415 (2590519) 2590519..2590860 - 342 WP_001190615.1 hypothetical protein -
OS083_RS13420 (2591377) 2591377..2592018 - 642 WP_021758233.1 pathogenicity island protein -
OS083_RS13425 (2592015) 2592015..2592299 - 285 WP_000998181.1 hypothetical protein -
OS083_RS13430 (2592301) 2592301..2592663 - 363 WP_001039168.1 hypothetical protein -
OS083_RS13435 (2592949) 2592949..2594418 - 1470 WP_000390454.1 virulence-associated E family protein -
OS083_RS13440 (2594435) 2594435..2595304 - 870 WP_001002732.1 primase alpha helix C-terminal domain-containing protein -
OS083_RS13445 (2595368) 2595368..2595688 - 321 WP_001103942.1 DUF1474 family protein Toxin
OS083_RS13450 (2595691) 2595691..2595900 - 210 WP_001058486.1 hypothetical protein Antitoxin
OS083_RS13455 (2595893) 2595893..2596039 - 147 WP_000784875.1 hypothetical protein -
OS083_RS13460 (2596051) 2596051..2596323 - 273 WP_000091731.1 helix-turn-helix domain-containing protein -
OS083_RS13465 (2596316) 2596316..2596579 - 264 WP_000243851.1 helix-turn-helix transcriptional regulator -
OS083_RS13470 (2596772) 2596772..2597104 + 333 WP_001260004.1 helix-turn-helix transcriptional regulator -
OS083_RS13475 (2597116) 2597116..2597574 + 459 WP_000281657.1 ImmA/IrrE family metallo-endopeptidase -
OS083_RS13480 (2597591) 2597591..2598022 + 432 WP_001228759.1 hypothetical protein -
OS083_RS13485 (2598092) 2598092..2598820 + 729 WP_001033316.1 staphylococcal enterotoxin type Q -
OS083_RS13490 (2598844) 2598844..2599572 + 729 WP_000733774.1 staphylococcal enterotoxin type K -
OS083_RS13495 (2599661) 2599661..2600881 + 1221 WP_000266157.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - seb / selq / selk / vWbp 2535404..2631623 96219


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12694.22 Da        Isoelectric Point: 4.7419

>T265207 WP_001103942.1 NZ_CP113027:c2595688-2595368 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT265207 WP_001058486.1 NZ_CP113027:c2595900-2595691 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q93CD4

Antitoxin

Source ID Structure

References