Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1473888..1474685 Replicon chromosome
Accession NZ_CP113027
Organism Staphylococcus aureus strain Syndra

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag OS083_RS07755 Protein ID WP_267814154.1
Coordinates 1473888..1474349 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag OS083_RS07760 Protein ID WP_001260487.1
Coordinates 1474362..1474685 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS083_RS07700 (1470412) 1470412..1470966 + 555 WP_000132890.1 alpha/beta hydrolase -
OS083_RS07745 (1472244) 1472244..1473293 - 1050 WP_000146088.1 site-specific integrase -
OS083_RS07750 (1473355) 1473355..1473870 - 516 WP_031790084.1 hypothetical protein -
OS083_RS07755 (1473888) 1473888..1474349 - 462 WP_267814154.1 toxin Toxin
OS083_RS07760 (1474362) 1474362..1474685 - 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
OS083_RS07765 (1474849) 1474849..1474977 + 129 WP_267825020.1 helix-turn-helix transcriptional regulator -
OS083_RS07770 (1475111) 1475111..1475554 + 444 WP_000435360.1 hypothetical protein -
OS083_RS07775 (1475569) 1475569..1475709 + 141 WP_000939495.1 hypothetical protein -
OS083_RS07780 (1475702) 1475702..1475911 - 210 WP_000772137.1 hypothetical protein -
OS083_RS07785 (1475968) 1475968..1476681 + 714 WP_031925041.1 BRO family protein -
OS083_RS07790 (1476694) 1476694..1476903 + 210 WP_000455727.1 hypothetical protein -
OS083_RS07795 (1476917) 1476917..1477078 + 162 WP_000048124.1 DUF1270 family protein -
OS083_RS07800 (1477167) 1477167..1477484 + 318 WP_000829613.1 hypothetical protein -
OS083_RS07805 (1477489) 1477489..1477749 + 261 WP_001556704.1 DUF1108 family protein -
OS083_RS07810 (1477762) 1477762..1478298 + 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
OS083_RS07815 (1478299) 1478299..1478949 + 651 WP_000840496.1 ERF family protein -
OS083_RS07820 (1478946) 1478946..1479389 + 444 WP_001099007.1 single-stranded DNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - see / sak / scn 1470412..1563829 93417


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18159.52 Da        Isoelectric Point: 4.6915

>T265202 WP_267814154.1 NZ_CP113027:c1474349-1473888 [Staphylococcus aureus]
MRLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT265202 WP_001260487.1 NZ_CP113027:c1474685-1474362 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References