Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1293060..1293589 | Replicon | chromosome |
Accession | NZ_CP113027 | ||
Organism | Staphylococcus aureus strain Syndra |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS083_RS06710 | Protein ID | WP_000621175.1 |
Coordinates | 1293227..1293589 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS083_RS06705 | Protein ID | WP_000948331.1 |
Coordinates | 1293060..1293230 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS083_RS06675 (1288096) | 1288096..1288656 | + | 561 | WP_001092405.1 | K(+)-transporting ATPase subunit C | - |
OS083_RS06680 (1288865) | 1288865..1289344 | + | 480 | WP_001287083.1 | hypothetical protein | - |
OS083_RS06685 (1289337) | 1289337..1290920 | + | 1584 | WP_001294642.1 | PH domain-containing protein | - |
OS083_RS06690 (1290907) | 1290907..1291398 | + | 492 | WP_001205915.1 | PH domain-containing protein | - |
OS083_RS06695 (1291402) | 1291402..1291761 | + | 360 | WP_000581194.1 | holo-ACP synthase | - |
OS083_RS06700 (1291827) | 1291827..1292975 | + | 1149 | WP_001280702.1 | alanine racemase | - |
OS083_RS06705 (1293060) | 1293060..1293230 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS083_RS06710 (1293227) | 1293227..1293589 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS083_RS06715 (1293938) | 1293938..1294939 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS083_RS06720 (1295058) | 1295058..1295384 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS083_RS06725 (1295386) | 1295386..1295865 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
OS083_RS06730 (1295840) | 1295840..1296610 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265200 WP_000621175.1 NZ_CP113027:1293227-1293589 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|