265191

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2487709..2488186 Replicon chromosome
Accession NZ_CP113018
Organism Staphylococcus aureus strain Taliyah

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS090_RS12910 Protein ID WP_000052078.1
Coordinates 2487998..2488186 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS090_RS12905 Protein ID WP_001059690.1
Coordinates 2487709..2487969 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS090_RS12870 (2483102) 2483102..2483818 - 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -
OS090_RS12875 (2483966) 2483966..2484388 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS090_RS12880 (2484787) 2484787..2485281 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS090_RS12885 (2485436) 2485436..2486053 + 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS090_RS12890 (2486126) 2486126..2486707 - 582 WP_001140686.1 histidine phosphatase family protein -
OS090_RS12895 (2486932) 2486932..2487168 + 237 WP_000368687.1 hypothetical protein -
OS090_RS12900 (2487165) 2487165..2487368 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS090_RS12905 (2487709) 2487709..2487969 + 261 WP_001059690.1 hypothetical protein Antitoxin
OS090_RS12910 (2487998) 2487998..2488186 + 189 WP_000052078.1 hypothetical protein Toxin
OS090_RS12915 (2488374) 2488374..2488943 + 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS090_RS12920 (2489031) 2489031..2489315 + 285 WP_001004395.1 hypothetical protein -
OS090_RS12925 (2489377) 2489377..2489595 + 219 WP_000005886.1 hypothetical protein -
OS090_RS12930 (2490091) 2490091..2490291 - 201 WP_001059082.1 cold-shock protein -
OS090_RS12935 (2490648) 2490648..2491334 - 687 WP_001548082.1 thermonuclease family protein -
OS090_RS12940 (2491675) 2491675..2492145 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp 2463441..2496129 32688


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265191 WP_000052078.1 NZ_CP113018:2487998-2488186 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265191 WP_001059690.1 NZ_CP113018:2487709-2487969 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References