Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 2470564..2471069 | Replicon | chromosome |
| Accession | NZ_CP113018 | ||
| Organism | Staphylococcus aureus strain Taliyah | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A0C6E6D5 |
| Locus tag | OS090_RS12775 | Protein ID | WP_001103946.1 |
| Coordinates | 2470564..2470857 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IA75 |
| Locus tag | OS090_RS12780 | Protein ID | WP_001058492.1 |
| Coordinates | 2470860..2471069 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS090_RS12745 (2465755) | 2465755..2466096 | - | 342 | WP_001190616.1 | hypothetical protein | - |
| OS090_RS12750 (2466545) | 2466545..2467186 | - | 642 | WP_267793744.1 | pathogenicity island protein | - |
| OS090_RS12755 (2467183) | 2467183..2467467 | - | 285 | WP_000998180.1 | hypothetical protein | - |
| OS090_RS12760 (2467469) | 2467469..2467831 | - | 363 | WP_001039172.1 | hypothetical protein | - |
| OS090_RS12765 (2468133) | 2468133..2469590 | - | 1458 | Protein_2455 | virulence-associated E family protein | - |
| OS090_RS12770 (2469607) | 2469607..2470476 | - | 870 | WP_001002691.1 | primase alpha helix C-terminal domain-containing protein | - |
| OS090_RS12775 (2470564) | 2470564..2470857 | - | 294 | WP_001103946.1 | DUF1474 family protein | Toxin |
| OS090_RS12780 (2470860) | 2470860..2471069 | - | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
| OS090_RS12785 (2471062) | 2471062..2471208 | - | 147 | WP_000784885.1 | hypothetical protein | - |
| OS090_RS12790 (2471220) | 2471220..2471492 | - | 273 | WP_001138298.1 | helix-turn-helix domain-containing protein | - |
| OS090_RS12795 (2471493) | 2471493..2471705 | - | 213 | WP_001063624.1 | helix-turn-helix transcriptional regulator | - |
| OS090_RS12800 (2471855) | 2471855..2472589 | + | 735 | WP_000142630.1 | helix-turn-helix transcriptional regulator | - |
| OS090_RS12805 (2472764) | 2472764..2473492 | + | 729 | WP_001033317.1 | staphylococcal enterotoxin type Q | - |
| OS090_RS12810 (2473516) | 2473516..2474244 | + | 729 | WP_000733773.1 | staphylococcal enterotoxin type K | - |
| OS090_RS12815 (2474332) | 2474332..2475552 | + | 1221 | WP_000264182.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selq / selk / vWbp | 2463441..2496129 | 32688 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11590.08 Da Isoelectric Point: 4.9594
>T265190 WP_001103946.1 NZ_CP113018:c2470857-2470564 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C6E6D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | X5IA75 |