265190

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2470564..2471069 Replicon chromosome
Accession NZ_CP113018
Organism Staphylococcus aureus strain Taliyah

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag OS090_RS12775 Protein ID WP_001103946.1
Coordinates 2470564..2470857 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag OS090_RS12780 Protein ID WP_001058492.1
Coordinates 2470860..2471069 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS090_RS12745 (2465755) 2465755..2466096 - 342 WP_001190616.1 hypothetical protein -
OS090_RS12750 (2466545) 2466545..2467186 - 642 WP_267793744.1 pathogenicity island protein -
OS090_RS12755 (2467183) 2467183..2467467 - 285 WP_000998180.1 hypothetical protein -
OS090_RS12760 (2467469) 2467469..2467831 - 363 WP_001039172.1 hypothetical protein -
OS090_RS12765 (2468133) 2468133..2469590 - 1458 Protein_2455 virulence-associated E family protein -
OS090_RS12770 (2469607) 2469607..2470476 - 870 WP_001002691.1 primase alpha helix C-terminal domain-containing protein -
OS090_RS12775 (2470564) 2470564..2470857 - 294 WP_001103946.1 DUF1474 family protein Toxin
OS090_RS12780 (2470860) 2470860..2471069 - 210 WP_001058492.1 hypothetical protein Antitoxin
OS090_RS12785 (2471062) 2471062..2471208 - 147 WP_000784885.1 hypothetical protein -
OS090_RS12790 (2471220) 2471220..2471492 - 273 WP_001138298.1 helix-turn-helix domain-containing protein -
OS090_RS12795 (2471493) 2471493..2471705 - 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
OS090_RS12800 (2471855) 2471855..2472589 + 735 WP_000142630.1 helix-turn-helix transcriptional regulator -
OS090_RS12805 (2472764) 2472764..2473492 + 729 WP_001033317.1 staphylococcal enterotoxin type Q -
OS090_RS12810 (2473516) 2473516..2474244 + 729 WP_000733773.1 staphylococcal enterotoxin type K -
OS090_RS12815 (2474332) 2474332..2475552 + 1221 WP_000264182.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp 2463441..2496129 32688


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T265190 WP_001103946.1 NZ_CP113018:c2470857-2470564 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT265190 WP_001058492.1 NZ_CP113018:c2471069-2470860 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References