265189

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 2230194..2230994 Replicon chromosome
Accession NZ_CP113018
Organism Staphylococcus aureus strain Taliyah

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag OS090_RS11560 Protein ID WP_172844569.1
Coordinates 2230530..2230994 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag OS090_RS11555 Protein ID WP_001260487.1
Coordinates 2230194..2230517 (+) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS090_RS11490 (2225592) 2225592..2226239 - 648 WP_023180130.1 ERF family protein -
OS090_RS11495 (2226240) 2226240..2226776 - 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
OS090_RS11500 (2226789) 2226789..2227049 - 261 WP_000291089.1 DUF1108 family protein -
OS090_RS11505 (2227141) 2227141..2227302 - 162 WP_001619936.1 DUF1270 family protein -
OS090_RS11510 (2227295) 2227295..2227423 - 129 WP_001559112.1 hypothetical protein -
OS090_RS11515 (2227482) 2227482..2227712 + 231 WP_000395457.1 hypothetical protein -
OS090_RS11520 (2227687) 2227687..2227863 - 177 WP_172844570.1 hypothetical protein -
OS090_RS11525 (2227903) 2227903..2228127 - 225 WP_000187184.1 hypothetical protein -
OS090_RS11530 (2228128) 2228128..2228907 - 780 WP_072466105.1 phage antirepressor KilAC domain-containing protein -
OS090_RS11535 (2228964) 2228964..2229173 + 210 WP_000642492.1 hypothetical protein -
OS090_RS11540 (2229163) 2229163..2229306 - 144 WP_000939498.1 hypothetical protein -
OS090_RS11545 (2229321) 2229321..2229767 - 447 WP_031767740.1 hypothetical protein -
OS090_RS11550 (2229881) 2229881..2230030 - 150 WP_267793740.1 hypothetical protein -
OS090_RS11555 (2230194) 2230194..2230517 + 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
OS090_RS11560 (2230530) 2230530..2230994 + 465 WP_172844569.1 toxin Toxin
OS090_RS11565 (2231026) 2231026..2231706 + 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
OS090_RS11570 (2231913) 2231913..2233298 + 1386 WP_172844568.1 recombinase family protein -
OS090_RS11575 (2233415) 2233415..2233588 - 174 WP_000290472.1 50S ribosomal protein L32 -
OS090_RS11580 (2233668) 2233668..2234225 - 558 WP_000872158.1 DUF177 domain-containing protein -
OS090_RS11585 (2234352) 2234352..2235491 + 1140 WP_000843599.1 nucleotidyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2191480..2238460 46980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18184.58 Da        Isoelectric Point: 4.7927

>T265189 WP_172844569.1 NZ_CP113018:2230530-2230994 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREVDVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT265189 WP_001260487.1 NZ_CP113018:2230194-2230517 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References