265183

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 1167055..1167680 Replicon chromosome
Accession NZ_CP113018
Organism Staphylococcus aureus strain Taliyah

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag OS090_RS05965 Protein ID WP_001179607.1
Coordinates 1167285..1167680 (+) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag OS090_RS05960 Protein ID WP_000258939.1
Coordinates 1167055..1167285 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS090_RS05895 (1162111) 1162111..1162593 + 483 WP_000833764.1 hypothetical protein -
OS090_RS05900 (1162607) 1162607..1162786 + 180 WP_000401832.1 hypothetical protein -
OS090_RS05905 (1162771) 1162771..1162956 + 186 WP_001187008.1 hypothetical protein -
OS090_RS05910 (1162972) 1162972..1163139 + 168 WP_000312832.1 hypothetical protein -
OS090_RS05915 (1163253) 1163253..1163408 + 156 WP_267789152.1 transcriptional regulator -
OS090_RS05920 (1163434) 1163434..1163706 + 273 WP_000691100.1 hypothetical protein -
OS090_RS05925 (1163721) 1163721..1164263 + 543 WP_000858632.1 hypothetical protein -
OS090_RS05930 (1164256) 1164256..1164432 + 177 WP_000063384.1 hypothetical protein -
OS090_RS05935 (1164452) 1164452..1164673 + 222 WP_000829423.1 hypothetical protein -
OS090_RS05940 (1164673) 1164673..1165398 + 726 WP_000197304.1 fructose-bisphosphatase class III -
OS090_RS05945 (1165391) 1165391..1165708 + 318 WP_001807410.1 hypothetical protein -
OS090_RS05950 (1165708) 1165708..1166358 + 651 WP_000411528.1 hypothetical protein -
OS090_RS05955 (1166358) 1166358..1166879 + 522 WP_000639078.1 metallophosphoesterase -
OS090_RS05960 (1167055) 1167055..1167285 + 231 WP_000258939.1 addiction module antitoxin Antitoxin
OS090_RS05965 (1167285) 1167285..1167680 + 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OS090_RS05970 (1167733) 1167733..1168173 + 441 WP_000889963.1 hypothetical protein -
OS090_RS05975 (1168190) 1168190..1168426 + 237 WP_224757061.1 hypothetical protein -
OS090_RS05980 (1168483) 1168483..1168977 + 495 WP_000280790.1 hypothetical protein -
OS090_RS05985 (1168981) 1168981..1169781 + 801 WP_000686449.1 metallophosphoesterase -
OS090_RS05990 (1169890) 1169890..1170612 + 723 WP_001043218.1 hypothetical protein -
OS090_RS05995 (1170827) 1170827..1171462 + 636 Protein_1146 aminoglycoside 6-adenylyltransferase -
OS090_RS06000 (1171459) 1171459..1171710 + 252 WP_002505594.1 hypothetical protein -
OS090_RS06005 (1171685) 1171685..1172125 + 441 Protein_1148 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage aph(3')-III / aac(6')-aph(2'') - 1130780..1205055 74275


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T265183 WP_001179607.1 NZ_CP113018:1167285-1167680 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT265183 WP_000258939.1 NZ_CP113018:1167055-1167285 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References