Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-doc |
| Location | 1167055..1167680 | Replicon | chromosome |
| Accession | NZ_CP113018 | ||
| Organism | Staphylococcus aureus strain Taliyah | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A380FZ43 |
| Locus tag | OS090_RS05965 | Protein ID | WP_001179607.1 |
| Coordinates | 1167285..1167680 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A380FXS4 |
| Locus tag | OS090_RS05960 | Protein ID | WP_000258939.1 |
| Coordinates | 1167055..1167285 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS090_RS05895 (1162111) | 1162111..1162593 | + | 483 | WP_000833764.1 | hypothetical protein | - |
| OS090_RS05900 (1162607) | 1162607..1162786 | + | 180 | WP_000401832.1 | hypothetical protein | - |
| OS090_RS05905 (1162771) | 1162771..1162956 | + | 186 | WP_001187008.1 | hypothetical protein | - |
| OS090_RS05910 (1162972) | 1162972..1163139 | + | 168 | WP_000312832.1 | hypothetical protein | - |
| OS090_RS05915 (1163253) | 1163253..1163408 | + | 156 | WP_267789152.1 | transcriptional regulator | - |
| OS090_RS05920 (1163434) | 1163434..1163706 | + | 273 | WP_000691100.1 | hypothetical protein | - |
| OS090_RS05925 (1163721) | 1163721..1164263 | + | 543 | WP_000858632.1 | hypothetical protein | - |
| OS090_RS05930 (1164256) | 1164256..1164432 | + | 177 | WP_000063384.1 | hypothetical protein | - |
| OS090_RS05935 (1164452) | 1164452..1164673 | + | 222 | WP_000829423.1 | hypothetical protein | - |
| OS090_RS05940 (1164673) | 1164673..1165398 | + | 726 | WP_000197304.1 | fructose-bisphosphatase class III | - |
| OS090_RS05945 (1165391) | 1165391..1165708 | + | 318 | WP_001807410.1 | hypothetical protein | - |
| OS090_RS05950 (1165708) | 1165708..1166358 | + | 651 | WP_000411528.1 | hypothetical protein | - |
| OS090_RS05955 (1166358) | 1166358..1166879 | + | 522 | WP_000639078.1 | metallophosphoesterase | - |
| OS090_RS05960 (1167055) | 1167055..1167285 | + | 231 | WP_000258939.1 | addiction module antitoxin | Antitoxin |
| OS090_RS05965 (1167285) | 1167285..1167680 | + | 396 | WP_001179607.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OS090_RS05970 (1167733) | 1167733..1168173 | + | 441 | WP_000889963.1 | hypothetical protein | - |
| OS090_RS05975 (1168190) | 1168190..1168426 | + | 237 | WP_224757061.1 | hypothetical protein | - |
| OS090_RS05980 (1168483) | 1168483..1168977 | + | 495 | WP_000280790.1 | hypothetical protein | - |
| OS090_RS05985 (1168981) | 1168981..1169781 | + | 801 | WP_000686449.1 | metallophosphoesterase | - |
| OS090_RS05990 (1169890) | 1169890..1170612 | + | 723 | WP_001043218.1 | hypothetical protein | - |
| OS090_RS05995 (1170827) | 1170827..1171462 | + | 636 | Protein_1146 | aminoglycoside 6-adenylyltransferase | - |
| OS090_RS06000 (1171459) | 1171459..1171710 | + | 252 | WP_002505594.1 | hypothetical protein | - |
| OS090_RS06005 (1171685) | 1171685..1172125 | + | 441 | Protein_1148 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | aph(3')-III / aac(6')-aph(2'') | - | 1130780..1205055 | 74275 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 15035.51 Da Isoelectric Point: 9.4574
>T265183 WP_001179607.1 NZ_CP113018:1167285-1167680 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380FZ43 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380FXS4 |