Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1101964..1102493 | Replicon | chromosome |
| Accession | NZ_CP113018 | ||
| Organism | Staphylococcus aureus strain Taliyah | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OS090_RS05555 | Protein ID | WP_000621175.1 |
| Coordinates | 1102131..1102493 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | OS090_RS05550 | Protein ID | WP_000948331.1 |
| Coordinates | 1101964..1102134 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS090_RS05520 (1097001) | 1097001..1097561 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
| OS090_RS05525 (1097769) | 1097769..1098248 | + | 480 | WP_001287088.1 | hypothetical protein | - |
| OS090_RS05530 (1098241) | 1098241..1099824 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| OS090_RS05535 (1099811) | 1099811..1100302 | + | 492 | WP_001205910.1 | PH domain-containing protein | - |
| OS090_RS05540 (1100306) | 1100306..1100665 | + | 360 | WP_000581200.1 | holo-ACP synthase | - |
| OS090_RS05545 (1100731) | 1100731..1101879 | + | 1149 | WP_001281145.1 | alanine racemase | - |
| OS090_RS05550 (1101964) | 1101964..1102134 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| OS090_RS05555 (1102131) | 1102131..1102493 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OS090_RS05560 (1102842) | 1102842..1103843 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| OS090_RS05565 (1103962) | 1103962..1104288 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| OS090_RS05570 (1104290) | 1104290..1104769 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| OS090_RS05575 (1104744) | 1104744..1105514 | + | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265182 WP_000621175.1 NZ_CP113018:1102131-1102493 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|