Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1765092..1765569 Replicon chromosome
Accession NZ_CP113016
Organism Staphylococcus aureus strain Azir

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag OS077_RS08845 Protein ID WP_000052076.1
Coordinates 1765092..1765280 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS077_RS08850 Protein ID WP_001059690.1
Coordinates 1765309..1765569 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS077_RS08815 1761127..1761603 + 477 WP_000824477.1 hypothetical protein -
OS077_RS08820 1761944..1762630 + 687 WP_001641381.1 thermonuclease family protein -
OS077_RS08825 1762987..1763187 + 201 WP_001059082.1 cold-shock protein -
OS077_RS08830 1763683..1763901 - 219 WP_000005887.1 hypothetical protein -
OS077_RS08835 1763963..1764247 - 285 WP_031590186.1 hypothetical protein -
OS077_RS08840 1764335..1764904 - 570 WP_267836631.1 lipoprotein N-acylation protein LnsA -
OS077_RS08845 1765092..1765280 - 189 WP_000052076.1 hypothetical protein Toxin
OS077_RS08850 1765309..1765569 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS077_RS08855 1765910..1766113 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS077_RS08860 1766110..1766346 - 237 WP_000368687.1 hypothetical protein -
OS077_RS08865 1766571..1767152 + 582 WP_001140697.1 histidine phosphatase family protein -
OS077_RS08870 1767225..1767842 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
OS077_RS08875 1767998..1768492 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS077_RS08880 1768891..1769313 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS077_RS08885 1769461..1770177 + 717 WP_031589686.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T265170 WP_000052076.1 NZ_CP113016:c1765280-1765092 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265170 WP_001059690.1 NZ_CP113016:c1765569-1765309 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References