Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 156203..156732 | Replicon | chromosome |
Accession | NZ_CP113016 | ||
Organism | Staphylococcus aureus strain Azir |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS077_RS00800 | Protein ID | WP_000621175.1 |
Coordinates | 156203..156565 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS077_RS00805 | Protein ID | WP_000948331.1 |
Coordinates | 156562..156732 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS077_RS00780 | 153181..153951 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
OS077_RS00785 | 153926..154405 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
OS077_RS00790 | 154407..154733 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS077_RS00795 | 154852..155853 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS077_RS00800 | 156203..156565 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS077_RS00805 | 156562..156732 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS077_RS00810 | 156817..157965 | - | 1149 | WP_001281154.1 | alanine racemase | - |
OS077_RS00815 | 158031..158390 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
OS077_RS00820 | 158394..158885 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
OS077_RS00825 | 158872..160455 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
OS077_RS00830 | 160448..160927 | - | 480 | WP_031590204.1 | hypothetical protein | - |
OS077_RS00835 | 161136..161696 | - | 561 | WP_001092410.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265164 WP_000621175.1 NZ_CP113016:c156565-156203 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|