Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2944686..2945215 | Replicon | chromosome |
Accession | NZ_CP113015 | ||
Organism | Staphylococcus aureus strain Zed |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS078_RS15240 | Protein ID | WP_000621175.1 |
Coordinates | 2944686..2945048 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS078_RS15245 | Protein ID | WP_000948331.1 |
Coordinates | 2945045..2945215 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS078_RS15220 (2941665) | 2941665..2942435 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
OS078_RS15225 (2942410) | 2942410..2942889 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
OS078_RS15230 (2942891) | 2942891..2943217 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS078_RS15235 (2943336) | 2943336..2944337 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS078_RS15240 (2944686) | 2944686..2945048 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS078_RS15245 (2945045) | 2945045..2945215 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS078_RS15250 (2945300) | 2945300..2946448 | - | 1149 | WP_001281145.1 | alanine racemase | - |
OS078_RS15255 (2946514) | 2946514..2946873 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
OS078_RS15260 (2946877) | 2946877..2947368 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
OS078_RS15265 (2947355) | 2947355..2948938 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
OS078_RS15270 (2948931) | 2948931..2949410 | - | 480 | WP_001287088.1 | hypothetical protein | - |
OS078_RS15275 (2949618) | 2949618..2950178 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265159 WP_000621175.1 NZ_CP113015:c2945048-2944686 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|