Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 2879499..2880124 Replicon chromosome
Accession NZ_CP113015
Organism Staphylococcus aureus strain Zed

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag OS078_RS14830 Protein ID WP_001179607.1
Coordinates 2879499..2879894 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag OS078_RS14835 Protein ID WP_000258939.1
Coordinates 2879894..2880124 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS078_RS14795 (2875235) 2875235..2875957 - 723 WP_001043218.1 hypothetical protein -
OS078_RS14800 (2876066) 2876066..2876866 - 801 WP_000686449.1 metallophosphoesterase -
OS078_RS14805 (2876870) 2876870..2877364 - 495 WP_000280790.1 hypothetical protein -
OS078_RS14810 (2877421) 2877421..2877690 - 270 WP_000755772.1 hypothetical protein -
OS078_RS14815 (2877674) 2877674..2877865 - 192 WP_032605691.1 hypothetical protein -
OS078_RS14820 (2877999) 2877999..2879171 + 1173 WP_000195429.1 IS256-like element IS256 family transposase -
OS078_RS14825 (2879198) 2879198..2879446 - 249 WP_267836466.1 hypothetical protein -
OS078_RS14830 (2879499) 2879499..2879894 - 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OS078_RS14835 (2879894) 2879894..2880124 - 231 WP_000258939.1 addiction module antitoxin Antitoxin
OS078_RS14840 (2880300) 2880300..2880821 - 522 WP_000639078.1 metallophosphoesterase -
OS078_RS14845 (2880821) 2880821..2881471 - 651 WP_000411528.1 hypothetical protein -
OS078_RS14850 (2881471) 2881471..2881788 - 318 WP_001807410.1 hypothetical protein -
OS078_RS14855 (2881781) 2881781..2882506 - 726 WP_000197304.1 fructose-bisphosphatase class III -
OS078_RS14860 (2882506) 2882506..2882727 - 222 WP_000829423.1 hypothetical protein -
OS078_RS14865 (2882747) 2882747..2882932 - 186 WP_129760514.1 hypothetical protein -
OS078_RS14870 (2882916) 2882916..2883458 - 543 WP_000858632.1 hypothetical protein -
OS078_RS14875 (2883473) 2883473..2883745 - 273 WP_000691100.1 hypothetical protein -
OS078_RS14880 (2883771) 2883771..2883926 - 156 WP_000792995.1 transcriptional regulator -
OS078_RS14885 (2884040) 2884040..2884207 - 168 WP_000312832.1 hypothetical protein -
OS078_RS14890 (2884223) 2884223..2884408 - 186 WP_001187008.1 hypothetical protein -
OS078_RS14895 (2884393) 2884393..2884572 - 180 WP_000401832.1 hypothetical protein -
OS078_RS14900 (2884586) 2884586..2885068 - 483 WP_000833764.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2875235..2916399 41164


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T265158 WP_001179607.1 NZ_CP113015:c2879894-2879499 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT265158 WP_000258939.1 NZ_CP113015:c2880124-2879894 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References