Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1814852..1815652 | Replicon | chromosome |
| Accession | NZ_CP113015 | ||
| Organism | Staphylococcus aureus strain Zed | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OS078_RS09225 | Protein ID | WP_172844569.1 |
| Coordinates | 1814852..1815316 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0C2LD36 |
| Locus tag | OS078_RS09230 | Protein ID | WP_001260487.1 |
| Coordinates | 1815329..1815652 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS078_RS09200 (1810355) | 1810355..1811494 | - | 1140 | WP_000843599.1 | nucleotidyltransferase | - |
| OS078_RS09205 (1811621) | 1811621..1812178 | + | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| OS078_RS09210 (1812258) | 1812258..1812431 | + | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| OS078_RS09215 (1812548) | 1812548..1813933 | - | 1386 | WP_172844568.1 | recombinase family protein | - |
| OS078_RS09220 (1814140) | 1814140..1814820 | - | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| OS078_RS09225 (1814852) | 1814852..1815316 | - | 465 | WP_172844569.1 | toxin | Toxin |
| OS078_RS09230 (1815329) | 1815329..1815652 | - | 324 | WP_001260487.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OS078_RS09235 (1815816) | 1815816..1816064 | + | 249 | WP_000272859.1 | helix-turn-helix transcriptional regulator | - |
| OS078_RS09240 (1816077) | 1816077..1816523 | + | 447 | WP_031767740.1 | hypothetical protein | - |
| OS078_RS09245 (1816538) | 1816538..1816681 | + | 144 | WP_000939498.1 | hypothetical protein | - |
| OS078_RS09250 (1816671) | 1816671..1816880 | - | 210 | WP_000642492.1 | hypothetical protein | - |
| OS078_RS09255 (1816937) | 1816937..1817716 | + | 780 | WP_072466105.1 | phage antirepressor KilAC domain-containing protein | - |
| OS078_RS09260 (1817717) | 1817717..1817941 | + | 225 | WP_000187184.1 | hypothetical protein | - |
| OS078_RS09265 (1817981) | 1817981..1818157 | + | 177 | WP_172844570.1 | hypothetical protein | - |
| OS078_RS09270 (1818132) | 1818132..1818362 | - | 231 | WP_000395457.1 | hypothetical protein | - |
| OS078_RS09275 (1818412) | 1818412..1818549 | + | 138 | WP_000230552.1 | hypothetical protein | - |
| OS078_RS09280 (1818542) | 1818542..1818703 | + | 162 | WP_001619936.1 | DUF1270 family protein | - |
| OS078_RS09285 (1818795) | 1818795..1819055 | + | 261 | WP_000291089.1 | DUF1108 family protein | - |
| OS078_RS09290 (1819068) | 1819068..1819604 | + | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| OS078_RS09295 (1819605) | 1819605..1820252 | + | 648 | WP_023180130.1 | ERF family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1807659..1854365 | 46706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18184.58 Da Isoelectric Point: 4.7927
>T265152 WP_172844569.1 NZ_CP113015:c1815316-1814852 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREVDVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID
MGLYEETLIQHDYIEIREVDVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|