Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1814852..1815652 Replicon chromosome
Accession NZ_CP113015
Organism Staphylococcus aureus strain Zed

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag OS078_RS09225 Protein ID WP_172844569.1
Coordinates 1814852..1815316 (-) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag OS078_RS09230 Protein ID WP_001260487.1
Coordinates 1815329..1815652 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS078_RS09200 (1810355) 1810355..1811494 - 1140 WP_000843599.1 nucleotidyltransferase -
OS078_RS09205 (1811621) 1811621..1812178 + 558 WP_000872158.1 DUF177 domain-containing protein -
OS078_RS09210 (1812258) 1812258..1812431 + 174 WP_000290472.1 50S ribosomal protein L32 -
OS078_RS09215 (1812548) 1812548..1813933 - 1386 WP_172844568.1 recombinase family protein -
OS078_RS09220 (1814140) 1814140..1814820 - 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
OS078_RS09225 (1814852) 1814852..1815316 - 465 WP_172844569.1 toxin Toxin
OS078_RS09230 (1815329) 1815329..1815652 - 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
OS078_RS09235 (1815816) 1815816..1816064 + 249 WP_000272859.1 helix-turn-helix transcriptional regulator -
OS078_RS09240 (1816077) 1816077..1816523 + 447 WP_031767740.1 hypothetical protein -
OS078_RS09245 (1816538) 1816538..1816681 + 144 WP_000939498.1 hypothetical protein -
OS078_RS09250 (1816671) 1816671..1816880 - 210 WP_000642492.1 hypothetical protein -
OS078_RS09255 (1816937) 1816937..1817716 + 780 WP_072466105.1 phage antirepressor KilAC domain-containing protein -
OS078_RS09260 (1817717) 1817717..1817941 + 225 WP_000187184.1 hypothetical protein -
OS078_RS09265 (1817981) 1817981..1818157 + 177 WP_172844570.1 hypothetical protein -
OS078_RS09270 (1818132) 1818132..1818362 - 231 WP_000395457.1 hypothetical protein -
OS078_RS09275 (1818412) 1818412..1818549 + 138 WP_000230552.1 hypothetical protein -
OS078_RS09280 (1818542) 1818542..1818703 + 162 WP_001619936.1 DUF1270 family protein -
OS078_RS09285 (1818795) 1818795..1819055 + 261 WP_000291089.1 DUF1108 family protein -
OS078_RS09290 (1819068) 1819068..1819604 + 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
OS078_RS09295 (1819605) 1819605..1820252 + 648 WP_023180130.1 ERF family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1807659..1854365 46706


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18184.58 Da        Isoelectric Point: 4.7927

>T265152 WP_172844569.1 NZ_CP113015:c1815316-1814852 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREVDVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT265152 WP_001260487.1 NZ_CP113015:c1815652-1815329 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References