265151

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 1576109..1576614 Replicon chromosome
Accession NZ_CP113015
Organism Staphylococcus aureus strain Zed

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag OS078_RS08020 Protein ID WP_001103946.1
Coordinates 1576321..1576614 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag OS078_RS08015 Protein ID WP_001058492.1
Coordinates 1576109..1576318 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS078_RS07980 (1571626) 1571626..1572846 - 1221 WP_000264182.1 site-specific integrase -
OS078_RS07985 (1572934) 1572934..1573662 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
OS078_RS07990 (1573686) 1573686..1574414 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
OS078_RS07995 (1574589) 1574589..1575323 - 735 WP_000142630.1 helix-turn-helix transcriptional regulator -
OS078_RS08000 (1575473) 1575473..1575685 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
OS078_RS08005 (1575686) 1575686..1575958 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
OS078_RS08010 (1575970) 1575970..1576116 + 147 WP_000784885.1 hypothetical protein -
OS078_RS08015 (1576109) 1576109..1576318 + 210 WP_001058492.1 hypothetical protein Antitoxin
OS078_RS08020 (1576321) 1576321..1576614 + 294 WP_001103946.1 DUF1474 family protein Toxin
OS078_RS08025 (1576702) 1576702..1577571 + 870 WP_001002691.1 primase alpha helix C-terminal domain-containing protein -
OS078_RS08030 (1577588) 1577588..1579045 + 1458 WP_000432707.1 virulence-associated E family protein -
OS078_RS08035 (1579347) 1579347..1579709 + 363 WP_001039172.1 hypothetical protein -
OS078_RS08040 (1579711) 1579711..1579995 + 285 WP_000998180.1 hypothetical protein -
OS078_RS08045 (1579992) 1579992..1580633 + 642 WP_267793744.1 pathogenicity island protein -
OS078_RS08050 (1581082) 1581082..1581423 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 1553676..1583737 30061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T265151 WP_001103946.1 NZ_CP113015:1576321-1576614 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT265151 WP_001058492.1 NZ_CP113015:1576109-1576318 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References