265150

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1558992..1559469 Replicon chromosome
Accession NZ_CP113015
Organism Staphylococcus aureus strain Zed

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS078_RS07885 Protein ID WP_000052078.1
Coordinates 1558992..1559180 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS078_RS07890 Protein ID WP_001059690.1
Coordinates 1559209..1559469 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS078_RS07855 (1555033) 1555033..1555503 + 471 WP_000824472.1 hypothetical protein -
OS078_RS07860 (1555844) 1555844..1556530 + 687 WP_001548082.1 thermonuclease family protein -
OS078_RS07865 (1556887) 1556887..1557087 + 201 WP_001059082.1 cold-shock protein -
OS078_RS07870 (1557583) 1557583..1557801 - 219 WP_000005886.1 hypothetical protein -
OS078_RS07875 (1557863) 1557863..1558147 - 285 WP_001004395.1 hypothetical protein -
OS078_RS07880 (1558235) 1558235..1558804 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS078_RS07885 (1558992) 1558992..1559180 - 189 WP_000052078.1 hypothetical protein Toxin
OS078_RS07890 (1559209) 1559209..1559469 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS078_RS07895 (1559810) 1559810..1560013 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS078_RS07900 (1560010) 1560010..1560246 - 237 WP_000368687.1 hypothetical protein -
OS078_RS07905 (1560471) 1560471..1561052 + 582 WP_001140686.1 histidine phosphatase family protein -
OS078_RS07910 (1561125) 1561125..1561742 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS078_RS07915 (1561897) 1561897..1562391 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS078_RS07920 (1562790) 1562790..1563212 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS078_RS07925 (1563360) 1563360..1564076 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 1553676..1583737 30061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265150 WP_000052078.1 NZ_CP113015:c1559180-1558992 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265150 WP_001059690.1 NZ_CP113015:c1559469-1559209 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References