Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 1835957..1836582 Replicon chromosome
Accession NZ_CP113009
Organism Staphylococcus aureus strain Orianna

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag OS092_RS09490 Protein ID WP_001179607.1
Coordinates 1835957..1836352 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag OS092_RS09495 Protein ID WP_000258939.1
Coordinates 1836352..1836582 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS092_RS09450 (1831512) 1831512..1831952 - 441 Protein_1825 GNAT family N-acetyltransferase -
OS092_RS09455 (1831927) 1831927..1832166 - 240 WP_232727579.1 streptothricin acetyltransferase -
OS092_RS09460 (1832175) 1832175..1832810 - 636 Protein_1827 aminoglycoside 6-adenylyltransferase -
OS092_RS09465 (1833025) 1833025..1833747 - 723 WP_001043218.1 hypothetical protein -
OS092_RS09470 (1833856) 1833856..1834656 - 801 WP_000686449.1 metallophosphoesterase -
OS092_RS09475 (1834660) 1834660..1835154 - 495 WP_000280790.1 hypothetical protein -
OS092_RS09480 (1835211) 1835211..1835447 - 237 WP_224757061.1 hypothetical protein -
OS092_RS09485 (1835464) 1835464..1835904 - 441 WP_000889963.1 hypothetical protein -
OS092_RS09490 (1835957) 1835957..1836352 - 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OS092_RS09495 (1836352) 1836352..1836582 - 231 WP_000258939.1 addiction module antitoxin Antitoxin
OS092_RS09500 (1836758) 1836758..1837279 - 522 WP_000639078.1 metallophosphoesterase -
OS092_RS09505 (1837279) 1837279..1837929 - 651 WP_000411528.1 hypothetical protein -
OS092_RS09510 (1837929) 1837929..1838246 - 318 WP_001807410.1 hypothetical protein -
OS092_RS09515 (1838239) 1838239..1838964 - 726 WP_000197304.1 fructose-bisphosphatase class III -
OS092_RS09520 (1838964) 1838964..1839185 - 222 WP_000829423.1 hypothetical protein -
OS092_RS09525 (1839205) 1839205..1839390 - 186 WP_129760514.1 hypothetical protein -
OS092_RS09530 (1839374) 1839374..1839916 - 543 WP_000858632.1 hypothetical protein -
OS092_RS09535 (1839931) 1839931..1840203 - 273 WP_000691100.1 hypothetical protein -
OS092_RS09540 (1840229) 1840229..1840384 - 156 WP_267789152.1 transcriptional regulator -
OS092_RS09545 (1840498) 1840498..1840665 - 168 WP_000312832.1 hypothetical protein -
OS092_RS09550 (1840681) 1840681..1840866 - 186 WP_001187008.1 hypothetical protein -
OS092_RS09555 (1840851) 1840851..1841030 - 180 WP_000401832.1 hypothetical protein -
OS092_RS09560 (1841044) 1841044..1841526 - 483 WP_000833764.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1833025..1869737 36712


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T265138 WP_001179607.1 NZ_CP113009:c1836352-1835957 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT265138 WP_000258939.1 NZ_CP113009:c1836582-1836352 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References