Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 576410..576915 Replicon chromosome
Accession NZ_CP113009
Organism Staphylococcus aureus strain Orianna

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag OS092_RS03025 Protein ID WP_001103946.1
Coordinates 576622..576915 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag OS092_RS03020 Protein ID WP_001058492.1
Coordinates 576410..576619 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS092_RS02985 (571927) 571927..573147 - 1221 WP_000264182.1 site-specific integrase -
OS092_RS02990 (573235) 573235..573963 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
OS092_RS02995 (573987) 573987..574715 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
OS092_RS03000 (574890) 574890..575624 - 735 WP_000142630.1 helix-turn-helix transcriptional regulator -
OS092_RS03005 (575774) 575774..575986 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
OS092_RS03010 (575987) 575987..576259 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
OS092_RS03015 (576271) 576271..576417 + 147 WP_000784885.1 hypothetical protein -
OS092_RS03020 (576410) 576410..576619 + 210 WP_001058492.1 hypothetical protein Antitoxin
OS092_RS03025 (576622) 576622..576915 + 294 WP_001103946.1 DUF1474 family protein Toxin
OS092_RS03030 (577003) 577003..577872 + 870 WP_001002691.1 primase alpha helix C-terminal domain-containing protein -
OS092_RS03035 (577889) 577889..579346 + 1458 WP_000432707.1 virulence-associated E family protein -
OS092_RS03040 (579648) 579648..580010 + 363 WP_001039172.1 hypothetical protein -
OS092_RS03045 (580012) 580012..580296 + 285 WP_000998180.1 hypothetical protein -
OS092_RS03050 (580293) 580293..580934 + 642 WP_267793744.1 pathogenicity island protein -
OS092_RS03055 (581383) 581383..581724 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 553977..584038 30061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T265132 WP_001103946.1 NZ_CP113009:576622-576915 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT265132 WP_001058492.1 NZ_CP113009:576410-576619 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References