Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 559293..559770 Replicon chromosome
Accession NZ_CP113009
Organism Staphylococcus aureus strain Orianna

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS092_RS02890 Protein ID WP_000052078.1
Coordinates 559293..559481 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS092_RS02895 Protein ID WP_001059690.1
Coordinates 559510..559770 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS092_RS02860 (555334) 555334..555804 + 471 WP_000824472.1 hypothetical protein -
OS092_RS02865 (556145) 556145..556831 + 687 WP_001548082.1 thermonuclease family protein -
OS092_RS02870 (557188) 557188..557388 + 201 WP_001059082.1 cold-shock protein -
OS092_RS02875 (557884) 557884..558102 - 219 WP_000005886.1 hypothetical protein -
OS092_RS02880 (558164) 558164..558448 - 285 WP_001004395.1 hypothetical protein -
OS092_RS02885 (558536) 558536..559105 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS092_RS02890 (559293) 559293..559481 - 189 WP_000052078.1 hypothetical protein Toxin
OS092_RS02895 (559510) 559510..559770 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS092_RS02900 (560111) 560111..560314 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS092_RS02905 (560311) 560311..560547 - 237 WP_000368687.1 hypothetical protein -
OS092_RS02910 (560772) 560772..561353 + 582 WP_001140686.1 histidine phosphatase family protein -
OS092_RS02915 (561426) 561426..562043 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS092_RS02920 (562198) 562198..562692 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS092_RS02925 (563091) 563091..563513 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS092_RS02930 (563661) 563661..564377 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 553977..584038 30061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265131 WP_000052078.1 NZ_CP113009:c559481-559293 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265131 WP_001059690.1 NZ_CP113009:c559770-559510 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References