Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2465340..2465817 Replicon chromosome
Accession NZ_CP113007
Organism Staphylococcus aureus strain Ryze

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS082_RS12605 Protein ID WP_000052078.1
Coordinates 2465629..2465817 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS082_RS12600 Protein ID WP_001059690.1
Coordinates 2465340..2465600 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS082_RS12565 (2460733) 2460733..2461449 - 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -
OS082_RS12570 (2461597) 2461597..2462019 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS082_RS12575 (2462418) 2462418..2462912 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS082_RS12580 (2463067) 2463067..2463684 + 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS082_RS12585 (2463757) 2463757..2464338 - 582 WP_001140686.1 histidine phosphatase family protein -
OS082_RS12590 (2464563) 2464563..2464799 + 237 WP_000368687.1 hypothetical protein -
OS082_RS12595 (2464796) 2464796..2464999 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS082_RS12600 (2465340) 2465340..2465600 + 261 WP_001059690.1 hypothetical protein Antitoxin
OS082_RS12605 (2465629) 2465629..2465817 + 189 WP_000052078.1 hypothetical protein Toxin
OS082_RS12610 (2466005) 2466005..2466574 + 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS082_RS12615 (2466662) 2466662..2466946 + 285 WP_001004395.1 hypothetical protein -
OS082_RS12620 (2467008) 2467008..2467226 + 219 WP_000005886.1 hypothetical protein -
OS082_RS12625 (2467723) 2467723..2467923 - 201 WP_001059082.1 cold-shock protein -
OS082_RS12630 (2468280) 2468280..2468966 - 687 WP_001548082.1 thermonuclease family protein -
OS082_RS12635 (2469307) 2469307..2469777 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp 2441072..2479471 38399


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265130 WP_000052078.1 NZ_CP113007:2465629-2465817 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265130 WP_001059690.1 NZ_CP113007:2465340-2465600 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References