Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2448195..2448700 Replicon chromosome
Accession NZ_CP113007
Organism Staphylococcus aureus strain Ryze

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag OS082_RS12470 Protein ID WP_001103946.1
Coordinates 2448195..2448488 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag OS082_RS12475 Protein ID WP_001058492.1
Coordinates 2448491..2448700 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS082_RS12440 (2443386) 2443386..2443727 - 342 WP_001190616.1 hypothetical protein -
OS082_RS12445 (2444176) 2444176..2444817 - 642 WP_267793744.1 pathogenicity island protein -
OS082_RS12450 (2444814) 2444814..2445098 - 285 WP_000998180.1 hypothetical protein -
OS082_RS12455 (2445100) 2445100..2445462 - 363 WP_001039172.1 hypothetical protein -
OS082_RS12460 (2445764) 2445764..2447221 - 1458 WP_000432707.1 virulence-associated E family protein -
OS082_RS12465 (2447238) 2447238..2448107 - 870 WP_001002691.1 primase alpha helix C-terminal domain-containing protein -
OS082_RS12470 (2448195) 2448195..2448488 - 294 WP_001103946.1 DUF1474 family protein Toxin
OS082_RS12475 (2448491) 2448491..2448700 - 210 WP_001058492.1 hypothetical protein Antitoxin
OS082_RS12480 (2448693) 2448693..2448839 - 147 WP_000784885.1 hypothetical protein -
OS082_RS12485 (2448851) 2448851..2449123 - 273 WP_001138298.1 helix-turn-helix domain-containing protein -
OS082_RS12490 (2449124) 2449124..2449336 - 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
OS082_RS12495 (2449486) 2449486..2450220 + 735 WP_000142630.1 helix-turn-helix transcriptional regulator -
OS082_RS12500 (2450395) 2450395..2451123 + 729 WP_001033317.1 staphylococcal enterotoxin type Q -
OS082_RS12505 (2451147) 2451147..2451875 + 729 WP_000733773.1 staphylococcal enterotoxin type K -
OS082_RS12510 (2451963) 2451963..2453183 + 1221 WP_000264182.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp 2441072..2479471 38399


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T265129 WP_001103946.1 NZ_CP113007:c2448488-2448195 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT265129 WP_001058492.1 NZ_CP113007:c2448700-2448491 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References